DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and TIGD5

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_116251.4 Gene:TIGD5 / 84948 HGNCID:18336 Length:642 Species:Homo sapiens


Alignment Length:145 Identity:35/145 - (24%)
Similarity:68/145 - (46%) Gaps:17/145 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RTSLTLEEKMEVIQ---SQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGL--LSGELKLNQ 69
            |.:.::::|::.|:   ..||.....||    |.:........||.:..::..|  |.||:...:
Human    53 RKAYSIKDKLQAIERVKGGERQASVCRD----FGVPGGTLRGWLKDEPKLRWFLEQLGGEVGTQR 113

  Fly    70 MRRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVEL--GHSNFSASSGWLEKWR 132
            .:....::.  :||...:.||..:|...:|:||.:::.:|:..|.::  ....|.||.||..:|:
Human   114 KKMRLANEE--EIDRAVYAWFLALRQHGVPLSGPLIQAQAEAFARQIYGPECTFKASHGWFWRWQ 176

  Fly   133 KRHNVR----YNDTG 143
            |||.:.    |.:.|
Human   177 KRHGISSQRFYGEAG 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 10/52 (19%)
CENPB 78..141 CDD:197828 20/68 (29%)
TIGD5NP_116251.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
HTH 53..102 CDD:304362 10/52 (19%)
HTH_Tnp_Tc5 122..182 CDD:281246 19/61 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 185..233 2/7 (29%)
rve 273..477 CDD:304425
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 535..587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 1 1.000 - - otm40429
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.