DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and Jrkl

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001028353.1 Gene:Jrkl / 77532 MGIID:1924782 Length:523 Species:Mus musculus


Alignment Length:176 Identity:49/176 - (27%)
Similarity:91/176 - (51%) Gaps:17/176 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQS-IKEGLLSGELKLNQM 70
            ::.|..||:::|:::|:..|... |.:.||..:.||:|...||.|:|:. |.....|....|...
Mouse     4 KRKRVVLTIKDKLDIIKKLEDGG-SSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAK 67

  Fly    71 RRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELG-HSNFSASSGWLEKWRKR 134
            |::.......::|:...:||::.|.:..||||.:..|:|:.....|| ..:|:.|:|||.::::|
Mouse    68 RKSMKPSMYEELDKAMLEWFNQQRAKGNPISGPICAKRAEFFFYALGMDGDFNPSAGWLTRFKQR 132

  Fly   135 HNVR----YND--TGDSLDLQEF--------EAILVKSEPISNKDD 166
            |::|    .|:  .||...:::|        |...::.|.|.|.|:
Mouse   133 HSIREINIRNERLNGDETAVEDFCNNFRDFIEQENLQPEQIYNADE 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 17/53 (32%)
CENPB 78..141 CDD:197828 20/67 (30%)
JrklNP_001028353.1 HTH 4..52 CDD:304362 16/48 (33%)
CENPB 73..139 CDD:197828 20/65 (31%)
DDE_1 206..385 CDD:281213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 1 1.000 - - otm42505
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.