DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and Pogk

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001136420.1 Gene:Pogk / 71592 MGIID:1918842 Length:626 Species:Mus musculus


Alignment Length:139 Identity:31/139 - (22%)
Similarity:61/139 - (43%) Gaps:31/139 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LSVRDLAKRFNIGK--------------TQAADILKHKQSIKE-GLLSGELK-----------LN 68
            ||..|||.:|...:              .:.|:...:.|:.|: |:|...::           .:
Mouse   200 LSADDLASKFQFSRGMRRSYDAGFKLMVVEYAESTNNCQAAKQFGVLEKNVRDWRKVKPQLQNAH 264

  Fly    69 QMR---RNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELG--HSNFSASSGWL 128
            .||   |.|.:.|.|.:|:...::...::.:..||:.|.::.||.::|.|:.  ...|.||.||.
Mouse   265 AMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWC 329

  Fly   129 EKWRKRHNV 137
            .:..:|:::
Mouse   330 RRMMRRYDL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 9/44 (20%)
CENPB 78..141 CDD:197828 16/62 (26%)
PogkNP_001136420.1 KRAB 68..123 CDD:214630
KRAB_A-box 68..105 CDD:143639
BrkDBD 214..266 CDD:286662 5/51 (10%)
CENPB 275..342 CDD:197828 16/64 (25%)
DDE_1 414..586 CDD:281213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.