Sequence 1: | NP_001260876.1 | Gene: | cag / 36157 | FlyBaseID: | FBgn0017414 | Length: | 225 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_060012.3 | Gene: | POGK / 57645 | HGNCID: | 18800 | Length: | 609 | Species: | Homo sapiens |
Alignment Length: | 195 | Identity: | 38/195 - (19%) |
---|---|---|---|
Similarity: | 79/195 - (40%) | Gaps: | 39/195 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 RKPRTSLTLEEKMEVIQ-SQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGELKLNQM 70
Fly 71 R---RNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELG--HSNFSASSGWLEK 130
Fly 131 WRKRHNVRYNDTGDSLDLQEFEAILVKSEPISNKDDCDEPYPVTLIEPIYSTEEAMMQLARLKEF 195
Fly 196 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cag | NP_001260876.1 | CENP-B_N | 7..60 | CDD:282122 | 12/53 (23%) |
CENPB | 78..141 | CDD:197828 | 16/64 (25%) | ||
POGK | NP_060012.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..28 | ||
KRAB | 49..107 | CDD:214630 | |||
KRAB_A-box | 49..86 | CDD:143639 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 100..127 | ||||
BrkDBD | 195..247 | CDD:286662 | 11/62 (18%) | ||
CENPB | 256..323 | CDD:197828 | 16/88 (18%) | ||
DDE_1 | 395..567 | CDD:281213 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 588..609 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3105 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1343623at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |