DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and POGK

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_060012.3 Gene:POGK / 57645 HGNCID:18800 Length:609 Species:Homo sapiens


Alignment Length:195 Identity:38/195 - (19%)
Similarity:79/195 - (40%) Gaps:39/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RKPRTSLTLEEKMEVIQ-SQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGELKLNQM 70
            |..|.|.....|:.|:: ::..|....   ||:|.:.:....|..|.|..::..        :.|
Human   194 RGMRRSYDAGFKLMVVEYAESTNNCQA---AKQFGVLEKNVRDWRKVKPQLQNA--------HAM 247

  Fly    71 R---RNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELG--HSNFSASSGWLEK 130
            |   |.|.:.|.|.:|:...::...::.:..||:.|.::.||.::|.|:.  ...|.||.||..:
Human   248 RRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWCRR 312

  Fly   131 WRKRHNVRYNDTGDSLDLQEFEAILVKSEPISNKDDCDEPYPVTLIEPIYSTEEAMMQLARLKEF 195
            ..:|:::                      .:.:|....:..|..|.|.:.:.:.:::.|.|..::
Human   313 MMRRYDL----------------------SLRHKVPVPQHLPEDLTEKLVTYQRSVLALRRAHDY 355

  Fly   196  195
            Human   356  355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 12/53 (23%)
CENPB 78..141 CDD:197828 16/64 (25%)
POGKNP_060012.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
KRAB 49..107 CDD:214630
KRAB_A-box 49..86 CDD:143639
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..127
BrkDBD 195..247 CDD:286662 11/62 (18%)
CENPB 256..323 CDD:197828 16/88 (18%)
DDE_1 395..567 CDD:281213
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 588..609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.