DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and pogzb

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001333153.1 Gene:pogzb / 561483 ZFINID:ZDB-GENE-100609-3 Length:1924 Species:Danio rerio


Alignment Length:138 Identity:33/138 - (23%)
Similarity:54/138 - (39%) Gaps:20/138 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PSGRVRKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHK-QSIKEGLLSGEL 65
            |:..||....|||:.::              |.|......|..:||..:..| |.||..:...|.
Zfish  1428 PTQPVRNREESLTIHQR--------------RILLLALCAGIQKAAKEMDTKPQLIKTWIQDKED 1478

  Fly    66 KLNQMRRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGH-SNFSASSGWLE 129
            :||:...   |..|..:|.: ..|....|.:..||:...:.:||.:|..:... |:|..|..|..
Zfish  1479 QLNECCS---SICGEAVDRL-VQWVLTQREQQRPINEARLFEKASELQSQTNETSSFRISYEWAV 1539

  Fly   130 KWRKRHNV 137
            .:..:|.:
Zfish  1540 NFMMQHKL 1547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 13/53 (25%)
CENPB 78..141 CDD:197828 14/61 (23%)
pogzbNP_001333153.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.