DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and Cenpb

DIOPT Version :10

Sequence 1:NP_477207.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001386248.1 Gene:Cenpb / 362217 RGDID:1304794 Length:603 Species:Rattus norvegicus


Alignment Length:134 Identity:47/134 - (35%)
Similarity:81/134 - (60%) Gaps:12/134 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RTSLTLEEKMEVIQSQERN-KLSVRDLAKRFNIGKTQAADILKHKQSI-----KEGLLSGELKLN 68
            |..||..||..:||..|.| .|...::|:||||..:..:.|||:|::|     |.|:.|...|.|
  Rat     5 RRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYGVASTCRKTN 69

  Fly    69 QMRRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHSNFSASSGWLEKWRK 133
            ::  :|..    :::.:...||.::|...:|:.|.::::||.::|.|||..:|:||:|||:::|:
  Rat    70 KL--SPYD----KLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEELGMDDFTASNGWLDRFRR 128

  Fly   134 RHNV 137
            ||.|
  Rat   129 RHGV 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_477207.1 CENP-B_N 7..56 CDD:461229 19/46 (41%)
CENPB 78..141 CDD:197828 21/60 (35%)
CenpbNP_001386248.1 CENP-B_N 2..56 CDD:461229 20/50 (40%)
CENPB 74..135 CDD:197828 21/63 (33%)
DDE_1 222..384 CDD:367380
CENP-B_dimeriz <542..602 CDD:462657
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.