DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and Jrkl

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001101592.1 Gene:Jrkl / 315417 RGDID:1308986 Length:524 Species:Rattus norvegicus


Alignment Length:176 Identity:50/176 - (28%)
Similarity:90/176 - (51%) Gaps:17/176 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQS-IKEGLLSGELKLNQM 70
            ::.|..||:::|:::|:..|... |.:.||..:.||:|...||.|:|:. |.....|....|...
  Rat     4 KRKRVVLTIKDKLDIIKKLEDGG-SSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAK 67

  Fly    71 RRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELG-HSNFSASSGWLEKWRKR 134
            |::.......::|....:||::.|.:..||||.:..|:|:.....|| ..:|:.|:|||.::::|
  Rat    68 RKSMKPSMYEELDRAMLEWFNQQRAKGNPISGPICAKRAEFFFYALGMDGDFNPSAGWLTRFKQR 132

  Fly   135 HNVR----YND--TGDSLDLQEF--------EAILVKSEPISNKDD 166
            |::|    .|:  .||...::||        |...::.|.|.|.|:
  Rat   133 HSIREINIRNERLNGDETAVEEFCNHFRDFIEQENLQPEQIYNADE 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 17/53 (32%)
CENPB 78..141 CDD:197828 20/67 (30%)
JrklNP_001101592.1 HTH 4..52 CDD:304362 16/48 (33%)
CENPB 73..139 CDD:197828 20/65 (31%)
DDE_1 206..385 CDD:281213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 1 1.000 - - otm44569
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.