DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and Jrk

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001098082.1 Gene:Jrk / 315073 RGDID:1306316 Length:557 Species:Rattus norvegicus


Alignment Length:210 Identity:54/210 - (25%)
Similarity:92/210 - (43%) Gaps:32/210 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GRVRKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGELK-- 66
            |..|| |..|||:||:::....||.: |.:.|.:.:|:|.:...||..||..:.....|.:.:  
  Rat    12 GEKRK-RVVLTLKEKIDICSRLERGE-SRKALMQEYNVGMSTLYDIKAHKAQLLSFFASSDSRQA 74

  Fly    67 LNQMRRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHSNFSA-SSGWLEK 130
            |.| ||...:.:...:|.:.::||...|.|.||:||.|:.:|||....::..:.... |.|||.:
  Rat    75 LEQ-RRTLHTPKLEHLDRVLYEWFLVKRAEGIPVSGPMLIEKAKDFYKQMRLTEPCVFSGGWLWR 138

  Fly   131 WRKRHNVRYNDTGDSLDLQEFEAILVKSEPISNKDDCD-----------EPYPVTLIEPIYSTEE 184
            ::.||.::..|......:         ::|.:.:..|.           .|      |.:||.:|
  Rat   139 FKARHGIKKLDASSEKQV---------ADPQAAEQFCGFFRSLAAEHGLSP------EQVYSADE 188

  Fly   185 AMMQLARLKEFAKDD 199
            ..:....|.....||
  Rat   189 TGLVWRCLPSSTPDD 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 18/52 (35%)
CENPB 78..141 CDD:197828 19/63 (30%)
JrkNP_001098082.1 CENP-B_N 14..66 CDD:282122 18/53 (34%)
CENPB 83..147 CDD:197828 19/63 (30%)
DDE_1 213..382 CDD:281213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 1 1.000 - - otm44569
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.