DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and Tigd5

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001119740.1 Gene:Tigd5 / 300034 RGDID:1311576 Length:642 Species:Rattus norvegicus


Alignment Length:135 Identity:33/135 - (24%)
Similarity:65/135 - (48%) Gaps:13/135 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RTSLTLEEKMEVIQ---SQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGL--LSGELKLNQ 69
            |.:.::::|::.|:   ..||.....||    |.:........||.:..::..|  |.||:...:
  Rat    62 RKAYSIKDKLQAIERVKGGERQASVCRD----FGVPGGTLRGWLKDEPKLRWFLDQLGGEVGTQR 122

  Fly    70 MRRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVEL--GHSNFSASSGWLEKWR 132
            .:....::.  :||...:.||..:|...:|:||.:::.:|:..|.::  ....|.||.||..:|:
  Rat   123 KKMRLANEE--EIDRAVYSWFLTLRQHGVPLSGPVIQAQAEAFARQIYGPECTFKASHGWFWRWQ 185

  Fly   133 KRHNV 137
            |||.:
  Rat   186 KRHGI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 10/52 (19%)
CENPB 78..141 CDD:197828 19/62 (31%)
Tigd5NP_001119740.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54
HTH 62..111 CDD:304362 10/52 (19%)
HTH_Tnp_Tc5 131..191 CDD:281246 19/62 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..230
rve 279..485 CDD:304425
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..583
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 1 1.000 - - otm44569
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.