DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and cbh1

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_594583.1 Gene:cbh1 / 2543290 PomBaseID:SPAC9E9.10c Length:514 Species:Schizosaccharomyces pombe


Alignment Length:184 Identity:41/184 - (22%)
Similarity:88/184 - (47%) Gaps:38/184 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RTSLTLEEKMEV--IQSQERNKLSVRDLAKRF------NIGKTQAADILKHKQS-IKEGLLS-GE 64
            |.:::|.||..:  ..:|..:::..:::.:.|      ::.::..::||..|.| :.:|.:. |:
pombe     5 RQAVSLAEKKAIRDYYNQSAHRIPQKEVTEWFRKTYNKDLSQSTISEILSPKYSYLDDGSVRLGD 69

  Fly    65 LKLNQMRRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQL------AVELGHSNFSA 123
            :|..:..:.||      :|...::|..:...|.:||||:|:::.|.:.      ...|...:|  
pombe    70 IKKIRAPKFPL------LDNAVYEWLQQREVEGLPISGDMIKQAATRFWSKIPAYASLPLPDF-- 126

  Fly   124 SSGWLEKWRKRHNVRYNDTGDSLDLQEFEAILVKSEPISNKDDCDEPYPVTLIE 177
            |:|||:|:|:||.::.:....:|:..:||..              ..|||.:.|
pombe   127 SNGWLDKFRRRHYIQQSAVNQALESIKFEVF--------------REYPVHIQE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 10/58 (17%)
CENPB 78..141 CDD:197828 19/68 (28%)
cbh1NP_594583.1 AAT_I <6..>103 CDD:302748 21/102 (21%)
CENPB 76..143 CDD:197828 21/74 (28%)
DDE_1 207..384 CDD:281213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 41 1.000 Domainoid score I3700
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.