DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and cbp1

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_596460.1 Gene:cbp1 / 2539971 PomBaseID:SPBC1105.04c Length:522 Species:Schizosaccharomyces pombe


Alignment Length:206 Identity:48/206 - (23%)
Similarity:94/206 - (45%) Gaps:49/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GRVRKPRTSLTLEEKMEVIQ--SQERNKLSVRDLAKRF------NIGKTQAADILKHKQSIKEGL 60
            |:::  |.::|..||..:..  .|.:|:...:||.:.|      :|.:...:.||..|.|..:..
pombe     2 GKIK--RRAITEHEKRALRHYFFQLQNRSGQQDLIEWFREKFGKDISQPSVSQILSSKYSYLDNT 64

  Fly    61 LS--GELKLNQMRRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHS---- 119
            :.  .::|.|:..:.||      ::...|:|..: :.::..:|||.:    |:.|..|.|.    
pombe    65 VEKPWDVKRNRPPKYPL------LEAALFEWQVQ-QGDDATLSGETI----KRAAAILWHKIPEY 118

  Fly   120 ------NFSASSGWLEKWRKRHNVRYNDTGDSLDLQEFEAILVK-----SEPISNKDDCDEPYPV 173
                  ||  |:||||.:||||.:.      :::.|..|::::.     ::|:|...|...   :
pombe   119 QDQPVPNF--SNGWLEGFRKRHILH------AINEQPTESVVLNNTEPPNDPLSRVYDVTR---L 172

  Fly   174 TLIEPIYSTEE 184
            |.|..|::.:|
pombe   173 TNINDIFTMQE 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 14/60 (23%)
CENPB 78..141 CDD:197828 20/72 (28%)
cbp1NP_596460.1 CENPB 76..144 CDD:197828 22/86 (26%)
DDE_1 208..385 CDD:281213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 41 1.000 Domainoid score I3700
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.