DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and cbh2

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_596738.1 Gene:cbh2 / 2539728 PomBaseID:SPBC14F5.12c Length:514 Species:Schizosaccharomyces pombe


Alignment Length:205 Identity:49/205 - (23%)
Similarity:95/205 - (46%) Gaps:44/205 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSGRVRKPRTSLTLEEKMEVIQS--QERNKLSVRDLAKRF------NIGKTQAADILKHKQSIK 57
            ||..|    |.:|||.||..:.:.  :...|.|.::|...|      .:.::..:.||..|....
pombe     1 MPPLR----RQALTLAEKKAIRKHYFESATKPSQQELISWFEEHFHKKLAQSTVSSILSSKNEFL 61

  Fly    58 EGLLSGELKLNQMRRNPLSQRGAQ--IDEMCFDWFSRVRTENIPISGEMVRKKAKQL------AV 114
            :.|   :.:.:|:|||   ::|..  ::....||.:|::.::..|:|..::|.|.:|      ..
pombe    62 DNL---DAENSQIRRN---RQGKYPILENALIDWQTRLQKQDGAITGNAIKKSAAELWRRIPEYS 120

  Fly   115 ELGHSNFSASSGWLEKWRKR---HNVRYNDTGDSLDLQEFEAILVKSEPISNKDDCDEPYPVTLI 176
            ||....|  |:|||||::||   |.::......|::...:|..:|:.:.:           ::|.
pombe   121 ELPIPEF--SNGWLEKFKKRCLKHGLKLQGESTSVNQGTYEENMVQIQEL-----------ISLF 172

  Fly   177 EP--IYSTEE 184
            :|  |::.:|
pombe   173 DPKDIFNMDE 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 13/60 (22%)
CENPB 78..141 CDD:197828 21/73 (29%)
cbh2NP_596738.1 CENPB 76..139 CDD:197828 19/64 (30%)
DDE_1 207..384 CDD:281213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 41 1.000 Domainoid score I3700
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.