powered by:
Protein Alignment cag and POGZ
DIOPT Version :9
Sequence 1: | NP_001260876.1 |
Gene: | cag / 36157 |
FlyBaseID: | FBgn0017414 |
Length: | 225 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016856233.1 |
Gene: | POGZ / 23126 |
HGNCID: | 18801 |
Length: | 1417 |
Species: | Homo sapiens |
Alignment Length: | 57 |
Identity: | 13/57 - (22%) |
Similarity: | 28/57 - (49%) |
Gaps: | 1/57 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 81 QIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHSNFSASSGWLEKWRKRHNV 137
:.:|...:|....|.:.:|::.|.:.:||.::...| ...|..|..|..::..||::
Human 1033 EAEEKLAEWVLTQREQQLPVNEETLFQKATKIGRSL-EGGFKISYEWAVRFMLRHHL 1088
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
cag | NP_001260876.1 |
CENP-B_N |
7..60 |
CDD:282122 |
|
CENPB |
78..141 |
CDD:197828 |
13/57 (23%) |
POGZ | XP_016856233.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3105 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.