DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment cag and Pogz

DIOPT Version :9

Sequence 1:	NP_001260876.1	Gene:	cag / 36157	FlyBaseID:	FBgn0017414	Length:	225	Species:	Drosophila melanogaster
Sequence 2:	NP_766271.2	Gene:	Pogz / 229584	MGIID:	2442117	Length:	1409	Species:	Mus musculus

Alignment Length:	57	Identity:	13/57 - (22%)
Similarity:	28/57 - (49%)	Gaps:	1/57 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    81 QIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHSNFSASSGWLEKWRKRHNV 137
            :.:|...:|....|.:.:|::.|.:.:||.::...| ...|..|..|..::..||::
Mouse  1022 EAEEKLAEWVLIQREQQLPVNEETLFQKATKIGRSL-EGGFKISYEWAVRFMLRHHL 1077

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
cag	NP_001260876.1	CENP-B_N	7..60	CDD:282122
cag	NP_001260876.1	CENPB	78..141	CDD:197828	13/57 (23%)
Pogz	NP_766271.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	238..293
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	331..356
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	406..455
		C2H2 Zn finger	493..526	CDD:275371
		C2H2 Zn finger	529..550	CDD:275368
		C2H2 Zn finger	559..580	CDD:275368
		C2H2 Zn finger	589..610	CDD:275368
		C2H2 Zn finger	618..638	CDD:275368
		Required for interaction with CBX5. /evidence=ECO:0000250	806..846
		PHA03247	<843..954	CDD:223021
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	904..966
		CENPB	1017..1078	CDD:197828	13/57 (23%)
		rve	1158..>1269	CDD:389805
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1356..1399
		Integrase domain-binding motif (IBM). /evidence=ECO:0000250\|UniProtKB:Q7Z3K3	1379..1403
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3105
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900