DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and TIGD3

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_663771.1 Gene:TIGD3 / 220359 HGNCID:18334 Length:471 Species:Homo sapiens


Alignment Length:193 Identity:55/193 - (28%)
Similarity:98/193 - (50%) Gaps:27/193 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGELKLNQMR 71
            :|...:|:|.||::|::..:.:|:|..::|:||.:.:.|.:.|.|:|:.:.....||  ..|:.|
Human     6 KKKLHALSLAEKIQVLELLDESKMSQSEVARRFQVSQPQISRICKNKEKLLADWCSG--TANRER 68

  Fly    72 RNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHSNFSASSGWLEKWRKRHN 136
            :.....:.:.|||....|:...|.:...::|.|:..|||:||..:| .:|..|.|||.:|::|:|
Human    69 KRKRESKYSGIDEALLCWYHIARAKAWDVTGPMLLHKAKELADIMG-QDFVPSIGWLVRWKRRNN 132

  Fly   137 VRYNDTGDSLDLQEFEAILVKSEPISNKDDCDEPYPVTLIEPIYSTEEAMMQLARLKEFAKDD 199
            |.:.          ...:|..|.|       .||.|..|      |.:|.:.|: ||:|:.:|
Human   133 VGFG----------ARHVLAPSFP-------PEPPPPGL------TSQAQLPLS-LKDFSPED 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 15/52 (29%)
CENPB 78..141 CDD:197828 22/62 (35%)
TIGD3NP_663771.1 HTH 6..57 CDD:328727 15/50 (30%)
HTH_Tnp_Tc5 76..133 CDD:308705 20/57 (35%)
rve 193..360 CDD:328789
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.