DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and TIGD4

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_663772.1 Gene:TIGD4 / 201798 HGNCID:18335 Length:512 Species:Homo sapiens


Alignment Length:153 Identity:43/153 - (28%)
Similarity:81/153 - (52%) Gaps:10/153 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGELKLNQMRR 72
            |.:.||::|||:::|.:.|..|... ::|..:.|.|...:.|:|:|..:.|...|  |:.:..|:
Human    16 KKKKSLSIEEKIDIINAVESGKKKA-EIAAEYGIKKNSLSSIMKNKDKVLEAFES--LRFDPKRK 77

  Fly    73 NPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHSNFSASSGWLEKWRKRHNV 137
            ...:.....::|....|:...:..|:|::|.|:|.||...|.:|||::|..|:|||::::.|:.:
Human    78 RLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQKLGHNDFKCSNGWLDRFKSRYGL 142

  Fly   138 RYNDTGDSLDLQEFEAILVKSEP 160
            .:.       .|..||..|..:|
Human   143 VFR-------AQPVEATGVPVDP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 16/51 (31%)
CENPB 78..141 CDD:197828 19/62 (31%)
TIGD4NP_663772.1 HTH 16..67 CDD:304362 16/51 (31%)
HTH_Tnp_Tc5 84..143 CDD:281246 19/58 (33%)
rve 211..375 CDD:304425
CENP-B_dimeris 427..>504 CDD:286159
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 434..472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 1 1.000 - - otm40429
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.