DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and TIGD1

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_663748.1 Gene:TIGD1 / 200765 HGNCID:14523 Length:591 Species:Homo sapiens


Alignment Length:226 Identity:53/226 - (23%)
Similarity:94/226 - (41%) Gaps:56/226 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQS-IKEGLLSGELKLNQM 70
            ||.||||||.:|:|:|:..|.. :|..::.:|..:.:...:.::..|:. :||...:..:....:
Human     9 RKSRTSLTLNQKLEMIKLSEEG-MSKAEIGRRLGLLRQTVSQVVNAKEKFLKEVKSATPMNTRMI 72

  Fly    71 R-RNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQL--------AVELGHSNFSASSG 126
            | ||.|.   |.::::...|.....:.|||:|..:::.||..|        .||.....|.||.|
Human    73 RKRNSLI---ADMEKVLVVWIEDQTSRNIPLSQSLIQNKALTLFNSMKAERGVEAAEEKFEASRG 134

  Fly   127 WLEKWRKR---HNVRYNDTGDSLDLQEFEAILVKSEPISNKDDCDEPYPVTLIEPIYSTEEAMMQ 188
            |..::::|   ||::......|.|                            :|...|..||:.:
Human   135 WFMRFKERSHFHNIKAQGEAASAD----------------------------VEAAASYPEALAK 171

  Fly   189 LARLKEFAKDDYASY--QQLISL-ENQWSWK 216
            :.        |...|  ||:.:: |..:.||
Human   172 II--------DEGGYTKQQIFNVDETAFYWK 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 17/53 (32%)
CENPB 78..141 CDD:197828 19/73 (26%)
TIGD1NP_663748.1 CENP-B_N 9..60 CDD:282122 15/51 (29%)
CENPB 76..149 CDD:197828 21/75 (28%)
DDE_1 216..403 CDD:281213
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 550..591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 1 1.000 - - otm40429
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.