DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and ptr-9

DIOPT Version :10

Sequence 1:NP_477207.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_499030.2 Gene:ptr-9 / 191747 WormBaseID:WBGene00004223 Length:844 Species:Caenorhabditis elegans


Alignment Length:130 Identity:36/130 - (27%)
Similarity:66/130 - (50%) Gaps:16/130 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 FSRVRTENIPISGEMVRKKAKQLAVELGHSNFSA-SSGWLEKWRKRH-NVRYNDTGDSLDLQEFE 152
            |:.||.|||.:...|||:....|..:||.|.:|: |..||:.:.|:: ..:|:::..|.:|..| 
 Worm   530 FALVRAENISLKDPMVRRNLIGLYRDLGGSEYSSPSEFWLDPFEKKNRGKKYSESDFSDELHTF- 593

  Fly   153 AILVKSEPISNKDDCDEPYPVTLIEPIYSTEEAMMQLARLKEFAKDD---YASYQQLISLENQWS 214
              |.|...:..::|    ...|::..|    |||..:.|:::..||:   .|.|.:.:...:|::
 Worm   594 --LAKEPHLKFRND----IRFTMMGKI----EAMKMMFRVRKLGKDNDAPRAEYMRKVMENSQFN 648

  Fly   215  214
             Worm   649  648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_477207.1 CENP-B_N 7..56 CDD:461229
CENPB 78..141 CDD:197828 19/52 (37%)
ptr-9NP_499030.2 Patched 52..812 CDD:308203 36/130 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.