DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and T13C2.2

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_495389.2 Gene:T13C2.2 / 188470 WormBaseID:WBGene00020478 Length:525 Species:Caenorhabditis elegans


Alignment Length:190 Identity:38/190 - (20%)
Similarity:78/190 - (41%) Gaps:40/190 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NKLSVRDLAKR--FNIGKTQAADILKHKQSIKEGLLSGELKLNQMRRNPLSQRGAQIDEMCFDWF 90
            ||..::.:|:.  |.:.|......:.|:  |:|..    .|:.:.:...||::..::....:...
 Worm    68 NKAPIQKMAETSVFLLEKRTITPKVMHQ--IRETY----EKIQKKKEGELSRKMNRLPPELYSTA 126

  Fly    91 SRVRTENIPISGEMV-RKKAKQLAVELGHSNFSASSGWLEKWRKRHNVRYNDTGDSLDLQEFEAI 154
            .:::|  |..||.:. .::.:.:.:.||....|.....||..:        :|...||...||  
 Worm   127 QKIKT--ISTSGGLSGNERVQHIEMALGALPSSYQRQILEILK--------ETPPKLDGATFE-- 179

  Fly   155 LVKSEPISNKDDCDEPYPVTLIEPIY----STE----EAMMQLARLKEFAKDDYASYQQL 206
                :|       ::|..||.:.|.:    :||    :.|..:...:||.::|:...|:|
 Worm   180 ----KP-------EKPIEVTSLPPSFAIPKNTESNENQRMFMVPERQEFPEEDHHFEQKL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 8/33 (24%)
CENPB 78..141 CDD:197828 9/63 (14%)
T13C2.2NP_495389.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.