DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and F21D5.4

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_501504.1 Gene:F21D5.4 / 184768 WormBaseID:WBGene00009009 Length:259 Species:Caenorhabditis elegans


Alignment Length:201 Identity:50/201 - (24%)
Similarity:93/201 - (46%) Gaps:39/201 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RKPRTSLTLEEKMEVIQ-SQERNKLSVRDLAKRFNIGKT--QAADILKHKQSIKEGLLSGELKLN 68
            :|.|.:.|||.|.|||: :::.|....:   |::.:.:.  |....|||:.:.:.....|..:|.
 Worm    18 KKKRANFTLEFKNEVIRFAEQTNNCQAQ---KKYGVARACIQRWRHLKHELAFESEGKQGAKRLG 79

  Fly    69 QMRRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHSNFSASSGWLEKWRK 133
            ...| ||  :..::||...||   :.::|..|||:.:::.||::.   |:::|.||:|||:::..
 Worm    80 GAGR-PL--KNVELDEKVEDW---IASKNGKISGKDIKEYAKKIN---GNADFKASNGWLQRFMI 135

  Fly   134 RHNVRYNDTGDSLDLQEFEAILVKSE------PISNKDDCDEPYPVTLIEPIYSTEEAMMQLARL 192
            ||.                  |:|:.      |.::....|:....:|.|.|.|.|...:....:
 Worm   136 RHG------------------LIKARSSSPKTPSTSDGTTDKTLEESLFELINSDEWKNISEGNV 182

  Fly   193 KEFAKD 198
            ..|.:|
 Worm   183 SGFLED 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 15/55 (27%)
CENPB 78..141 CDD:197828 19/62 (31%)
F21D5.4NP_501504.1 BrkDBD 21..65 CDD:286662 14/46 (30%)
CENPB 84..143 CDD:197828 23/84 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.