DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and Y53G8AM.8

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_497682.3 Gene:Y53G8AM.8 / 175430 WormBaseID:WBGene00021808 Length:854 Species:Caenorhabditis elegans


Alignment Length:190 Identity:37/190 - (19%)
Similarity:82/190 - (43%) Gaps:41/190 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SLTLEEKMEVIQSQERNKLSVRDLAKRF-----NIGKTQAADILKHKQSIKEGLL---------- 61
            ||..|.:.:::...:. ::.:.::::||     ::.:|.....|..:..|.|.||          
 Worm   521 SLPFESRRQILIIYDA-EIPILEISRRFSCTVRSVQETIGTRTLITRHQIAEFLLENPESPDSPD 584

  Fly    62 -----SGELKLNQMRRNPLSQ----RGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELG 117
                 |....:..|.| |.|:    ....:::|.:..|...:...|.|:|:.::.:|.:.|.::|
 Worm   585 ITTAPSKNSTIGDMMR-PKSKIRRTHYVDLNKMVWRHFKDCQAAGIQINGKQLKDQAMRYAKDMG 648

  Fly   118 HSNFSASSGWLEKWRKRHNVRY-----------NDTGDSLDLQ----EFEAILVKSEPIS 162
            ..:|..|.|||:.:::||.:..           ||..:.:|.:    :.|:.::..:|.|
 Worm   649 LESFRGSEGWLDAFKRRHRIDLKSMTGYPVCYENDMYEEVDKECRELDMESHMLHQQPPS 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 9/52 (17%)
CENPB 78..141 CDD:197828 15/73 (21%)
Y53G8AM.8NP_497682.3 CENPB 607..671 CDD:197828 15/63 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.