DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and Y48G1C.6

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_490670.1 Gene:Y48G1C.6 / 171597 WormBaseID:WBGene00021679 Length:223 Species:Caenorhabditis elegans


Alignment Length:193 Identity:40/193 - (20%)
Similarity:85/193 - (44%) Gaps:22/193 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VRKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLL-SGELKLNQ 69
            |:..:.:..|:.|:..|.....:| ::...||..|:.:......:..|..|::.|. :|.....:
 Worm    10 VKTRKRTYDLKFKLHAINYALEHK-NISKAAKDLNVNRQNIQQWIAQKAEIEKQLEDNGSTATKR 73

  Fly    70 MRRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHSNFSASSGWLEKWRKR 134
            :.......:...:|:....|....|.|...::..::.:.||:::   .:|:|.||.|||:|:..|
 Worm    74 LSGGGRPLKYDDVDKELIKWVHDQRKEKQRVTRRIIGETAKKIS---QNSDFKASRGWLDKFMCR 135

  Fly   135 HNV----RYNDTGDSLDLQEFEAILVKSEPISNKDDCDEPYPVTLI--------EPIYSTEEA 185
            ||:    ...:.||.  :|....||::.   ::.||.:|...::.|        :|:...::|
 Worm   136 HNLSTRRARTEPGDL--MQTLVDILLRQ---TSSDDGEEDPMISFIKSCIPSGEDPLEGEDQA 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 9/52 (17%)
CENPB 78..141 CDD:197828 17/66 (26%)
Y48G1C.6NP_490670.1 HTH_28 21..79 CDD:379233 10/58 (17%)
CENPB 80..142 CDD:197828 17/64 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.