DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and TIGD2

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001369309.1 Gene:TIGD2 / 166815 HGNCID:18333 Length:525 Species:Homo sapiens


Alignment Length:137 Identity:42/137 - (30%)
Similarity:78/137 - (56%) Gaps:11/137 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSI-----KEGLLSGELK 66
            ::.|..||:::|:::|:..|.. :|.:.|:..:.||::...||.|:|:.|     .....||..|
Human     4 KRKRVVLTIKDKLDIIKKLEEG-ISFKKLSVVYGIGESTVRDIKKNKERIINYANSSDPTSGVSK 67

  Fly    67 LNQMRRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELG-HSNFSASSGWLEK 130
            ...|:    |....::|.:..:||::.:|:.||:||.:..|:||.....|| ..:|:||||||.:
Human    68 RKSMK----SSTYEELDRVMIEWFNQQKTDGIPVSGTICAKQAKFFFDALGMEGDFNASSGWLTR 128

  Fly   131 WRKRHNV 137
            :::||.:
Human   129 FKQRHGI 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 15/57 (26%)
CENPB 78..141 CDD:197828 22/61 (36%)
TIGD2NP_001369309.1 HTH 4..52 CDD:419669 14/48 (29%)
HTH_Tnp_Tc5 76..135 CDD:397365 22/58 (38%)
DDE_1 207..385 CDD:367380
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 442..474
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 1 1.000 - - otm40429
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.