DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and LOC1281713

DIOPT Version :10

Sequence 1:NP_477207.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_321665.4 Gene:LOC1281713 / 1281713 VectorBaseID:AGAMI1_004056 Length:614 Species:Anopheles gambiae


Alignment Length:106 Identity:27/106 - (25%)
Similarity:44/106 - (41%) Gaps:10/106 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGRVRKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGELKL 67
            |.|.||..:..|.::....|........|:|..|...|:.:|..:..||   |:|.|.:|   ||
Mosquito     7 SNRCRKTSSPYTKQDLKNAINLIVERGTSIRRAAFVCNVPRTTLSTYLK---SLKHGKIS---KL 65

  Fly    68 NQMRRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKK 108
            .......|.|   .:.:.|...|| ::..|:..:.|.:.:|
Mosquito    66 LPQEEQALYQ---WMTDCCKRGFS-IKQRNVETAAEALVQK 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_477207.1 CENP-B_N 7..56 CDD:461229 11/48 (23%)
CENPB 78..141 CDD:197828 6/31 (19%)
LOC1281713XP_321665.4 None

Return to query results.
Submit another query.