DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and CENPB

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001801.1 Gene:CENPB / 1059 HGNCID:1852 Length:599 Species:Homo sapiens


Alignment Length:134 Identity:47/134 - (35%)
Similarity:81/134 - (60%) Gaps:12/134 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RTSLTLEEKMEVIQSQERN-KLSVRDLAKRFNIGKTQAADILKHKQSI-----KEGLLSGELKLN 68
            |..||..||..:||..|.| .|...::|:||||..:..:.|||:|::|     |.|:.|...|.|
Human     5 RRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYGVASTCRKTN 69

  Fly    69 QMRRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHSNFSASSGWLEKWRK 133
            ::  :|..    :::.:...||.::|...:|:.|.::::||.::|.|||..:|:||:|||:::|:
Human    70 KL--SPYD----KLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEELGMDDFTASNGWLDRFRR 128

  Fly   134 RHNV 137
            ||.|
Human   129 RHGV 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 21/55 (38%)
CENPB 78..141 CDD:197828 21/60 (35%)
CENPBNP_001801.1 DNA binding domain 1..125 43/125 (34%)
CENP-B_N 2..56 CDD:282122 20/50 (40%)
CENPB 74..135 CDD:197828 21/63 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..184
DDE_1 222..384 CDD:281213
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..475
CENP-B_dimeris <539..598 CDD:286159
dimerization domain 541..599
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10353
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 1 1.000 - - otm40429
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.