DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and Tigd4

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_006232614.1 Gene:Tigd4 / 102550932 RGDID:1305780 Length:514 Species:Rattus norvegicus


Alignment Length:153 Identity:43/153 - (28%)
Similarity:82/153 - (53%) Gaps:10/153 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGELKLNQMRR 72
            |.:.||::|||:::|.:.|..|... ::|..:.|.|...:.|:|:|..:.|...|  |:.:..|:
  Rat    16 KKKKSLSIEEKIDIINAVESGKKKA-EIAAEYGIKKNSLSSIMKNKDKVLEAFES--LRFDPKRK 77

  Fly    73 NPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHSNFSASSGWLEKWRKRHNV 137
            ...:.....::|....|:...:..|:|::|.|:|.||...|.:|||::|..|:|||::::.|:.:
  Rat    78 RLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQKLGHNDFKCSNGWLDRFKSRYGL 142

  Fly   138 RYNDTGDSLDLQEFEAILVKSEP 160
            .:.       .|..||..|.::|
  Rat   143 VFR-------AQPVEATGVSTDP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 16/51 (31%)
CENPB 78..141 CDD:197828 19/62 (31%)
Tigd4XP_006232614.1 HTH 16..67 CDD:304362 16/51 (31%)
HTH_Tnp_Tc5 84..143 CDD:281246 19/58 (33%)
rve 211..375 CDD:304425
CENP-B_dimeris 428..>506 CDD:286159
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 1 1.000 - - otm44569
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.