DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and Tigd2

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001292109.1 Gene:Tigd2 / 100912924 RGDID:1559612 Length:526 Species:Rattus norvegicus


Alignment Length:197 Identity:53/197 - (26%)
Similarity:95/197 - (48%) Gaps:41/197 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSI-----KEGLLSGELK 66
            ::.|..||:::|:::|:..|... |.:.|:..:.||::...||.|:|:.|     .....||..|
  Rat     4 KRKRVVLTIKDKLDIIKKLEEGN-SFKKLSVLYGIGESTVRDIKKNKERIINYANNSDPTSGVSK 67

  Fly    67 LNQMRRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELG-HSNFSASSGWLEK 130
            ...|:    |....::|.:..:||::.:|..||:||.:..|:|:.....|| ..:|:||||||.:
  Rat    68 RKSMK----SSTYEELDRVMIEWFNQQKTNGIPVSGTICAKQARFFFDALGMEGDFNASSGWLTR 128

  Fly   131 WRKRHNV----------RYNDTGDSL---DLQEFEAILVKSEPISNKDDCDEPYPVTLIEPIYST 182
            :::||.:          :.::|..|.   :.|||    ||.|.:             |.|.||..
  Rat   129 FKQRHGIPKAAGKGTKLKGDETAASEFCGNFQEF----VKRENL-------------LPEQIYGA 176

  Fly   183 EE 184
            ::
  Rat   177 DQ 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 15/57 (26%)
CENPB 78..141 CDD:197828 21/73 (29%)
Tigd2NP_001292109.1 HTH 4..52 CDD:389747 14/48 (29%)
HTH_Tnp_Tc5 76..135 CDD:367403 21/58 (36%)
DDE_1 207..385 CDD:367380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 1 1.000 - - otm44569
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.