DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and pogza

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001201839.1 Gene:pogza / 100535215 ZFINID:ZDB-GENE-040914-76 Length:1277 Species:Danio rerio


Alignment Length:108 Identity:24/108 - (22%)
Similarity:47/108 - (43%) Gaps:19/108 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGELKLNQMRRNPLSQRG 79
            |.|.::|::::.::.....|.....|....:.|::::   |:.|.||:.:|            :|
Zfish  1175 LTEVLDVLKAEPKHLFRSFDWILSTNESSEEPAELMR---SLTEALLASKL------------QG 1224

  Fly    80 AQIDEMCFDWFSRVRTEN--IPISGEMVRKK--AKQLAVELGH 118
            .:::|...:..|.|..|:  .|.|..:..||  .|...||..|
Zfish  1225 DKVEEQKAETSSVVSAESWPSPQSSILALKKIFEKDSDVETFH 1267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 8/44 (18%)
CENPB 78..141 CDD:197828 13/45 (29%)
pogzaNP_001201839.1 C2H2 Zn finger 432..453 CDD:275368
C2H2 Zn finger 462..483 CDD:275368
rve 1027..>1134 CDD:304425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.