DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and tigd5

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_012820589.1 Gene:tigd5 / 100491467 XenbaseID:XB-GENE-6257697 Length:536 Species:Xenopus tropicalis


Alignment Length:185 Identity:44/185 - (23%)
Similarity:80/185 - (43%) Gaps:43/185 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGELKLNQMRRNP 74
            |.:.::::|:|.|:              |...|:.||:  :.....:..|.|.|.||..|..|..
 Frog     7 RKAYSIKDKLEAIE--------------RVKNGERQAS--VSRDFGVPGGTLRGWLKDEQKLRWF 55

  Fly    75 LSQRGA---------------QIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVEL--GHSNFS 122
            |.|.|.               :||...:.||..:|.:.||:||.:::.:|:..|.::  ....|.
 Frog    56 LDQLGGDVGTHRKKMRLANEEEIDRAVYSWFISLRQQGIPLSGPIIQAQAEAFAKQIYGDECTFK 120

  Fly   123 ASSGWLEKWRKRHNVR----YNDTGDSLDLQEFEAILVKSE----PISNKDDCDE 169
            ||.||..:|:|||.:.    |.::  .:...|.:.:::..|    |:::....||
 Frog   121 ASHGWFWRWQKRHGISSQRIYGES--EVRQTEMDPVIIFPEQPNTPVADSGYGDE 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 8/49 (16%)
CENPB 78..141 CDD:197828 22/83 (27%)
tigd5XP_012820589.1 HTH 7..56 CDD:304362 15/64 (23%)
HTH_Tnp_Tc5 76..136 CDD:281246 20/59 (34%)
rve 208..387 CDD:304425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 1 1.000 - - otm47604
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.