DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and jrk

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_002941410.1 Gene:jrk / 100486859 XenbaseID:XB-GENE-6462335 Length:727 Species:Xenopus tropicalis


Alignment Length:224 Identity:53/224 - (23%)
Similarity:99/224 - (44%) Gaps:45/224 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGELKLNQMR 71
            ::.|.||::::|:.::|..| |..||:.|..::.||.:...|:.|.|..:.....:.:.......
 Frog   181 KRKRVSLSIKDKVTLLQDLE-NGASVKSLCDKYGIGTSTIYDLKKQKDKLLTFYSNSDAPDLMAD 244

  Fly    72 RNPLSQ-RGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHSNFSA----SSGWLEKW 131
            |..|.| :...:|::..:|..:.|.||.|:|..::..:||:..|.|   |.|.    ||||..|:
 Frog   245 RKTLHQAKNVSVDKVLMEWIRQRRRENFPLSRSLIMAQAKKFHVLL---NISTPCEYSSGWYGKF 306

  Fly   132 RKRHNVRYNDTGDSLDLQEFEAILVKSEPISNKDDCDEPYPVTLIEPIYSTEEAMMQLARLKEFA 196
            :||:.:               :||     ..|.:...|.|.|           |...:.:|.:..
 Frog   307 KKRNGL---------------SIL-----SINGEKASEEYNV-----------ADNFVKKLNKLV 340

  Fly   197 KDDYASYQQLISLENQWSWKWNIFKKELP 225
            .|::.|.:|:.:     :.|.::|.:.||
 Frog   341 SDEHLSAEQVYN-----AAKASLFWRHLP 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 15/52 (29%)
CENPB 78..141 CDD:197828 20/66 (30%)
jrkXP_002941410.1 HTH 181..232 CDD:304362 15/51 (29%)
HTH_Tnp_Tc5 253..313 CDD:281246 20/77 (26%)
rve 383..563 CDD:304425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.