DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and tigd3

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001128294.1 Gene:tigd3 / 100135169 XenbaseID:XB-GENE-6457180 Length:595 Species:Xenopus tropicalis


Alignment Length:137 Identity:37/137 - (27%)
Similarity:75/137 - (54%) Gaps:13/137 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGELKLNQMRR 72
            |.|...||.||:::::..::.|.|...:|:...:.::..:.::|:::.|.|       :.|| ..
 Frog    18 KKRRDSTLAEKVKILELLQQPKASQSSVARNLGLSQSTISRVMKNREEIME-------RWNQ-NE 74

  Fly    73 NPLSQRG-----AQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHSNFSASSGWLEKWR 132
            ||..:|.     |::||...:|....:...:||||.::.::|:.:|.|:|...|..|:|||.:|:
 Frog    75 NPARKRNRPFKHAKVDEALLEWLLFAKANKLPISGPILMRRAEAIAKEIGCPQFKPSNGWLWRWK 139

  Fly   133 KRHNVRY 139
            :|:.:.|
 Frog   140 ERYRLFY 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 12/51 (24%)
CENPB 78..141 CDD:197828 21/67 (31%)
tigd3NP_001128294.1 HTH 18..68 CDD:304362 11/49 (22%)
CENPB 83..147 CDD:197828 20/64 (31%)
rve 248..421 CDD:304425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 1 1.000 - - otm47604
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.