DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30020 and Zfp688

DIOPT Version :9

Sequence 1:NP_610627.2 Gene:CG30020 / 36156 FlyBaseID:FBgn0050020 Length:1309 Species:Drosophila melanogaster
Sequence 2:NP_081275.3 Gene:Zfp688 / 69234 MGIID:1916484 Length:274 Species:Mus musculus


Alignment Length:90 Identity:20/90 - (22%)
Similarity:40/90 - (44%) Gaps:16/90 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   716 DFDDEQSKHLQKPYCIYCNKKFTSQYKFENHMFVHRGLAPYRCELCTNLYNMKRLLIKHYKTVHK 780
            |....|.:|:    |:.|.::||......:|..:|.|..|:.|..|...:. ::..:|.::.:|:
Mouse   173 DIQASQRRHV----CVDCGRRFTYPSLLVSHRRMHSGERPFPCPECGVRFK-RKFAVKAHQWIHR 232

  Fly   781 -----RMPTRDMVQA------KGDK 794
                 |...|..::|      :||:
Mouse   233 SCSGGRRGRRPGIRAVPGAPVRGDR 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30020NP_610627.2 zf-AD 25..106 CDD:285071
C2H2 Zn finger 369..389 CDD:275368
C2H2 Zn finger 397..418 CDD:275368
C2H2 Zn finger 442..460 CDD:275368
C2H2 Zn finger 730..750 CDD:275368 5/19 (26%)
C2H2 Zn finger 758..777 CDD:275368 3/18 (17%)
C2H2 Zn finger 1089..1110 CDD:275368
C2H2 Zn finger 1124..1144 CDD:275368
C2H2 Zn finger 1151..1172 CDD:275368
C2H2 Zn finger 1180..1203 CDD:275368
C2H2 Zn finger 1210..1230 CDD:275368
C2H2 Zn finger 1238..1254 CDD:275368
Zfp688NP_081275.3 KRAB 26..86 CDD:214630
KRAB 26..65 CDD:279668
COG5048 <166..>233 CDD:227381 15/64 (23%)
zf-C2H2 181..203 CDD:278523 6/25 (24%)
C2H2 Zn finger 183..203 CDD:275368 5/19 (26%)
zf-H2C2_2 196..220 CDD:290200 6/24 (25%)
C2H2 Zn finger 211..231 CDD:275368 3/20 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832304
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.