DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG30020 and ZNF747

DIOPT Version :9

Sequence 1:	NP_610627.2	Gene:	CG30020 / 36156	FlyBaseID:	FBgn0050020	Length:	1309	Species:	Drosophila melanogaster
Sequence 2:	NP_001291947.1	Gene:	ZNF747 / 65988	HGNCID:	28350	Length:	331	Species:	Homo sapiens

Alignment Length:	166	Identity:	45/166 - (27%)
Similarity:	71/166 - (42%)	Gaps:	36/166 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly  1162 AELERHTKAKHSK-------------DKTLRCFMDGCRKTFAFKHHLIRHQKASHLSTRYICPVC 1213
            |.||:.:||:...             |:...|::  |.|:||::..|:.|..:......:.|..|
Human   153 AGLEQLSKARRRSRPRFFAHPPVPRADQRHGCYV--CGKSFAWRSTLVEHIYSHRGEKPFHCADC 215

  Fly  1214 NKEEKSNVHLKNHMSVHKGEITYKCPKCDRSYLRRGRLVTHALIIH--DLRFTTEELGNLSSLAT 1276
            .|.......|..|.::|:||..::||:|.|:::||..|.:| |.:|  :..:...:.|....|.|
Human   216 GKGFGHASSLSKHRAIHRGERPHRCPECGRAFMRRTALTSH-LRVHTGEKPYRCPQCGRCFGLKT 279

  Fly  1277 NQA----------------RPNDLKVA-TPV-GLLD 1294
            ..|                ||..|.|. ||| |.||
Human   280 GMAKHQWVHRPGGEGRRGRRPGGLSVTLTPVRGDLD 315

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG30020	NP_610627.2	zf-AD	25..106	CDD:285071
		C2H2 Zn finger	369..389	CDD:275368
		C2H2 Zn finger	397..418	CDD:275368
		C2H2 Zn finger	442..460	CDD:275368
		C2H2 Zn finger	730..750	CDD:275368
		C2H2 Zn finger	758..777	CDD:275368
		C2H2 Zn finger	1089..1110	CDD:275368
		C2H2 Zn finger	1124..1144	CDD:275368
		C2H2 Zn finger	1151..1172	CDD:275368	5/9 (56%)
		C2H2 Zn finger	1180..1203	CDD:275368	7/22 (32%)
		C2H2 Zn finger	1210..1230	CDD:275368	5/19 (26%)
		C2H2 Zn finger	1238..1254	CDD:275368	7/15 (47%)
ZNF747	NP_001291947.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..32
		KRAB	37..96	CDD:214630
		KRAB	37..76	CDD:279668
		C2H2 Zn finger	184..204	CDD:275368	7/21 (33%)
		zf-H2C2_2	197..219	CDD:290200	5/21 (24%)
		C2H2 Zn finger	212..232	CDD:275368	5/19 (26%)
		zf-H2C2_2	224..247	CDD:290200	9/22 (41%)
		COG5048	236..>273	CDD:227381	10/37 (27%)
		C2H2 Zn finger	240..260	CDD:275368	9/20 (45%)
		zf-H2C2_2	252..275	CDD:290200	5/23 (22%)
		C2H2 Zn finger	268..288	CDD:275368	4/19 (21%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165142306
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930