DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30020 and ZNF302

DIOPT Version :9

Sequence 1:NP_610627.2 Gene:CG30020 / 36156 FlyBaseID:FBgn0050020 Length:1309 Species:Drosophila melanogaster
Sequence 2:XP_016882467.1 Gene:ZNF302 / 55900 HGNCID:13848 Length:444 Species:Homo sapiens


Alignment Length:466 Identity:105/466 - (22%)
Similarity:180/466 - (38%) Gaps:85/466 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   841 NDGVSEHANEVFIIRKLPFECPRCI---------------RSFAAKTTLSRHLQRSHLVDTIIEM 890
            |.||::.:||..:.:....|...|.               ..:|...:..|.|.:..:|.....:
Human    20 NCGVNKMSNEELVGQNHGMEGEACTGGDVTFSDVAIDFSHEEWACLDSAQRDLYKDVMVQNYENL 84

  Fly   891 QTPHCGEAITTTMATSSSTISEP-VNSVTVDGQHNEMMQTDVGAEKMTEALGNGDGNEEGGTDDG 954
                        ::.:..::::| |..:..||:...||:     :|:::...:...|:|..|   
Human    85 ------------VSVAGLSVTKPYVIMLLEDGKEPWMME-----KKLSKDWESRWENKELST--- 129

  Fly   955 TGVKAEPAVPEEELDPVTLDAATAVTTTAIAAAISAAAAATATSLESPVATTASSSTTLFPTPTP 1019
                .:....|:...|||::.....:    ....::......|..::..:|..|.||...|....
Human   130 ----KKDIYDEDSPQPVTMEKVVKQS----YEFSNSNKNLEYTECDTFRSTFHSKSTLSEPQNNS 186

  Fly  1020 FD---FDYDIMRDEAQQ----SSPNIHDVSKALSDNASSSCPINESYKLLST---------TALE 1068
            .:   ..|||::....:    .|..|:...|.|:.|.|.:. .|:|..|...         |..|
Human   187 AEGNSHKYDILKKNLSKKSVIKSERINGGKKLLNSNKSGAA-FNQSKSLTLPQTCNREKIYTCSE 250

  Fly  1069 TSPAKGLRS----NSRLHR-SSIHICKLCNQTFDELGKLVKHEMELHSNTERSRWGYQHKCAICN 1128
            ...|.|.:|    :.|:|. ...:.|:.|.:||.....|.:|::. ||..:      .:||..|.
Human   251 CGKAFGKQSILSRHWRIHTGEKPYECRECGKTFSHGSSLTRHQIS-HSGEK------PYKCIECG 308

  Fly  1129 TSYRTLTLLKFHMKRHSNRKS-QCKLCPKSFVTIAELERHTKAKHSKDKTLRCFMDGCRKTFAFK 1192
            .::...:.|..|...|:..|. :|..|.|||..::.|.:|.:. |:::|...|.:  |.|.|...
Human   309 KAFSHGSSLTNHQSTHTGEKPYECMNCGKSFSRVSLLIQHLRI-HTQEKRYECRI--CGKAFIHS 370

  Fly  1193 HHLIRHQKASHLSTR-YICPVCNKEEKSNVHLKNHMSVHKGEITYKCPKCDRSYLRRGRLVTHAL 1256
            ..||.||| ||...: |.|..|.|....:.||..|..:|..:..|:|.||.:.:.....||.|. 
Human   371 SSLIHHQK-SHTGEKPYECRECGKAFCCSSHLTQHQRIHSMKKKYECNKCLKVFSSFSFLVQHQ- 433

  Fly  1257 IIHDLRFTTEE 1267
            .||     |||
Human   434 SIH-----TEE 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30020NP_610627.2 zf-AD 25..106 CDD:285071
C2H2 Zn finger 369..389 CDD:275368
C2H2 Zn finger 397..418 CDD:275368
C2H2 Zn finger 442..460 CDD:275368
C2H2 Zn finger 730..750 CDD:275368
C2H2 Zn finger 758..777 CDD:275368
C2H2 Zn finger 1089..1110 CDD:275368 6/20 (30%)
C2H2 Zn finger 1124..1144 CDD:275368 4/19 (21%)
C2H2 Zn finger 1151..1172 CDD:275368 7/20 (35%)
C2H2 Zn finger 1180..1203 CDD:275368 9/22 (41%)
C2H2 Zn finger 1210..1230 CDD:275368 6/19 (32%)
C2H2 Zn finger 1238..1254 CDD:275368 5/15 (33%)
ZNF302XP_016882467.1 KRAB 48..109 CDD:214630 8/72 (11%)
COG5048 <151..393 CDD:227381 63/257 (25%)
C2H2 Zn finger 248..268 CDD:275368 5/19 (26%)
C2H2 Zn finger 276..296 CDD:275368 6/20 (30%)
C2H2 Zn finger 304..324 CDD:275368 4/19 (21%)
C2H2 Zn finger 332..352 CDD:275368 7/20 (35%)
C2H2 Zn finger 360..380 CDD:275368 9/22 (41%)
C2H2 Zn finger 388..408 CDD:275368 6/19 (32%)
C2H2 Zn finger 416..436 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.