DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30020 and CG17803

DIOPT Version :9

Sequence 1:NP_610627.2 Gene:CG30020 / 36156 FlyBaseID:FBgn0050020 Length:1309 Species:Drosophila melanogaster
Sequence 2:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster


Alignment Length:830 Identity:143/830 - (17%)
Similarity:225/830 - (27%) Gaps:369/830 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   544 TITESGDINVVVDATPLFYAATSNSLLVTNPAPVTTVEETTGTASNHAF--GIFPEISEGNLPVN 606
            |:..|..:|..:  ..||.|...:|     .|..||......|.::.||  ..|.|.|.|     
  Fly    22 TMRSSRQVNKKL--VKLFLAEADDS-----DATCTTSTALDTTTADSAFFDSDFEEESTG----- 74

  Fly   607 EAVQQA---PANSSS-----VSVFGDMQDFIDNTDVAAICTIPA-DGMPVVDG------------ 650
              :|:.   ||:...     :|...|.||..|..::|.:..|.. .|:.:..|            
  Fly    75 --LQECDPPPASKCRTCFRIISRHEDAQDLYDRVNIALLHHIKVITGVWIQQGVKELPHHICSTC 137

  Fly   651 DDIVIDNNNISLDFDA-----ENLFEDFEEEEDDTVADEEDEADNED----------------EN 694
            .:.|    |.|::|.|     :.......|:.:..:.|||.|::.|:                |:
  Fly   138 QETV----NKSMEFRAKCQQVDKKLRQTTEKYNIQICDEEMESELENVLYEESAQQAKGVVGLED 198

  Fly   695 DNNDAATDQNLLLTSDD--------------DDVD-------DFDDEQSKHLQKPYCI-YCNKKF 737
            .:::...|...:|..||              |::|       ||..||:|...:...| .|..| 
  Fly   199 FSSELLPDSEGVLDEDDFPLDAEPTQFSLSEDELDLDRDTEKDFALEQNKSCNEIISIRKCKTK- 262

  Fly   738 TSQYKFENHMFVHRGLAPYRCELCTNLYNMKRLLIKHYKTVHKRMPTRDMVQAKGDKVSVARTNI 802
                  |....|..|...|            ::::..|.::.:..|...:...|..::.|:....
  Fly   263 ------EEIGKVDHGAKVY------------KVVLGEYNSLKETAPKYSLSLPKKPQLRVSPEEK 309

  Fly   803 EKLYPGRIKNPML--MCAKCPFECESDSEMRKHLNAHHGINDGVSEHANEVFIIRKLPFECPRCI 865
            .:....||:...|  :|.||.......|:::.||..|:                |...||||.|.
  Fly   310 NRRRRERIQAKPLNYVCDKCGHTFRQRSQLQMHLLRHN----------------RAKNFECPECP 358

  Fly   866 RSFAAKTTLSRHLQRSHLVDTIIEMQTPHCGEAITTTMATSSSTISEPVNSVTVDGQHNEMMQTD 930
            :.|....|.:.|::..|                                     .|:|       
  Fly   359 KKFYDLYTRNIHVRALH-------------------------------------KGEH------- 379

  Fly   931 VGAEKMTEALGNGDGNEEGGTDDGTGVKAEPAVPEEELDPVTLDAATAVTTTAIAAAISAAAAAT 995
                                                                             
  Fly   380 ----------------------------------------------------------------- 379

  Fly   996 ATSLESPVATTASSSTTLFPTPTPFDFDYDIMRDEAQQSSPNIHDVSKALSDNASSSCPINESYK 1060
                                   ||.                                       
  Fly   380 -----------------------PFP--------------------------------------- 382

  Fly  1061 LLSTTALETSPAKGLRSNSRLHRSSIHICKLCNQTFDELGKLVKHEMELHSNTERSR-------- 1117
                                        |..||::|.......:||.::|....|.|        
  Fly   383 ----------------------------CNHCNESFANASSRHRHERDVHGAGNRIRTRVKSKEE 419

  Fly  1118 WGYQHKCAICNTSYRTLTLLKFHMKRHS-NRKSQCKLCPKSFVTIAELERHTKAKHSKDKTLRCF 1181
            ...:|.|..|..||.:...|..||..|: :|..|||:|...|...:.::|| :|.|.| ..:|| 
  Fly   420 GSSRHYCTQCTKSYTSKKGLVLHMNFHNGSRPFQCKICQMKFADPSAMKRH-QALHDK-FPIRC- 481

  Fly  1182 MDGCRKTFAFKHHLIRHQKASHLSTRYICPVCNKEEKSNVHLKNHMSVHKGEITYKCPKCDRSYL 1246
             |.|.|.|..:..|.:||                            .||.|...::|..||..|.
  Fly   482 -DICLKGFLLRSQLTKHQ----------------------------DVHTGMHPHRCEICDVHYR 517

  Fly  1247 RRGRLVTHALIIHDL------RFTTEELGNLSSLATNQARPNDLKVATPV 1290
            .|..|..|...  ||      :...||:..|.....:..:..|.:..||:
  Fly   518 HRYNLNKHKNT--DLHRDNMQKAIKEEVNGLQQAFKDIDKEMDFESQTPM 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30020NP_610627.2 zf-AD 25..106 CDD:285071
C2H2 Zn finger 369..389 CDD:275368
C2H2 Zn finger 397..418 CDD:275368
C2H2 Zn finger 442..460 CDD:275368
C2H2 Zn finger 730..750 CDD:275368 4/20 (20%)
C2H2 Zn finger 758..777 CDD:275368 1/18 (6%)
C2H2 Zn finger 1089..1110 CDD:275368 6/20 (30%)
C2H2 Zn finger 1124..1144 CDD:275368 7/19 (37%)
C2H2 Zn finger 1151..1172 CDD:275368 7/20 (35%)
C2H2 Zn finger 1180..1203 CDD:275368 8/22 (36%)
C2H2 Zn finger 1210..1230 CDD:275368 0/19 (0%)
C2H2 Zn finger 1238..1254 CDD:275368 6/15 (40%)
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 14/77 (18%)
COG5048 <323..528 CDD:227381 69/451 (15%)
zf-C2H2 324..346 CDD:278523 6/21 (29%)
C2H2 Zn finger 326..346 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..375 CDD:275368 6/20 (30%)
C2H2 Zn finger 383..401 CDD:275368 5/17 (29%)
C2H2 Zn finger 426..446 CDD:275368 7/19 (37%)
C2H2 Zn finger 454..474 CDD:275368 7/20 (35%)
C2H2 Zn finger 481..501 CDD:275368 8/49 (16%)
C2H2 Zn finger 509..528 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439996
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.