DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30020 and CG6254

DIOPT Version :9

Sequence 1:NP_610627.2 Gene:CG30020 / 36156 FlyBaseID:FBgn0050020 Length:1309 Species:Drosophila melanogaster
Sequence 2:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster


Alignment Length:524 Identity:115/524 - (21%)
Similarity:191/524 - (36%) Gaps:95/524 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   760 LCTNLYNMKRLLIKHYKTVHKRMPTRDMVQAKGDKVSVARTNIEKLYPGRIKNPMLMCAKCPFEC 824
            ||:..:.:...||:..:.|.|       ||....|:.:.::           |.::...|...:|
  Fly    71 LCSECFTLMDCLIEFSERVRK-------VQILFSKLQLLQS-----------NNLMDYEKIREDC 117

  Fly   825 ESDSEMRKHLNAHHGINDGVSEHANEVFIIRKLPFECPRCIRSFAAKTTLSRHLQRSHLV--DTI 887
            ...::..||:..  |..|......:||||..:.|..|         :|..|..::...|:  :.:
  Fly   118 GVATDGWKHIML--GAVDESLPQNDEVFISEEQPIVC---------QTETSSKMKSEILMIPNFL 171

  Fly   888 IEMQTPHCGEAITTTMATSSSTISEPVNSVTVDGQHNEMMQTDVG---AEKMTEALGNGDGNEEG 949
            :|.|   |.:. ..........|.|   .:.:.|...|:::.||.   ||:..|.:     .||.
  Fly   172 VEKQ---CLQE-KQDFPKEEDVIEE---EMQISGVEEEILEEDVEEDLAEEEVETV-----EEEI 224

  Fly   950 GTDDGTGVKAEPAVPEEELDPVTLDAATAVTTTAIAAAISAAAAATATSLESPVATTASSSTTLF 1014
            .|     |..|....||||:  |.||...:...............:....||.|:          
  Fly   225 DT-----VGEEVEAVEEELE--TQDATDCLVEEVEHMTEDRYIEESQIIEESQVS---------- 272

  Fly  1015 PTPTPFDFD---YDIMRDEAQQSSPNIHDVSKALSDNASSSCPINESYKLLSTTALETSPAKGLR 1076
                  ||:   |:|::...|:......|..:::..|..:...|:..:.......:...||    
  Fly   273 ------DFNMETYEIVQHNPQKEPVETKDTVESIESNEDTQEDISREHVTDEEDEISEVPA---- 327

  Fly  1077 SNSRLHRSSIHICKLCNQTFDELGKLVKHEMELHSNTERSRWGYQHKCAICNTSYRTLTLLKFHM 1141
                     ::.|.:|.:.:.:.....:|..|:|:......  .|.:|..|...:.|:..|..|.
  Fly   328 ---------MYKCNICKKPYKKPKAYKRHMEEVHNTVADDL--PQLECNQCKLCFPTVAQLHAHH 381

  Fly  1142 KRHSNRKSQ----CKLCPKSFVTIAELERHTKAKHSKDKTLRCFMDGCRKTFAFKHHLIRHQKAS 1202
            :.|...|.:    |..|.|.|.|...|:||.:..|::.|...|  |.|.|:|.:...|..|:...
  Fly   382 RTHVRAKPKTDNCCPHCEKRFTTSGTLKRHIEGIHNQIKPYVC--DLCGKSFNYITGLKDHKLVH 444

  Fly  1203 HLSTRYICPVCNKEEKSNVHLKNHMSVHKGEITYKCPKCDRSYLRRGRLVTHALIIHDLR-FTTE 1266
            .....:.||||.:..|:|..||.|:..|..|| |:|..|......|.....|.|:..|.| |..|
  Fly   445 TDECPFECPVCKRGFKNNARLKIHLDTHSAEI-YECTVCGLKLKTRRTFNKHKLVHSDTRQFKCE 508

  Fly  1267 ELGN 1270
            ..|:
  Fly   509 VCGS 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30020NP_610627.2 zf-AD 25..106 CDD:285071
C2H2 Zn finger 369..389 CDD:275368
C2H2 Zn finger 397..418 CDD:275368
C2H2 Zn finger 442..460 CDD:275368
C2H2 Zn finger 730..750 CDD:275368
C2H2 Zn finger 758..777 CDD:275368 4/16 (25%)
C2H2 Zn finger 1089..1110 CDD:275368 4/20 (20%)
C2H2 Zn finger 1124..1144 CDD:275368 5/19 (26%)
C2H2 Zn finger 1151..1172 CDD:275368 8/20 (40%)
C2H2 Zn finger 1180..1203 CDD:275368 7/22 (32%)
C2H2 Zn finger 1210..1230 CDD:275368 9/19 (47%)
C2H2 Zn finger 1238..1254 CDD:275368 3/15 (20%)
CG6254NP_649983.2 zf-AD 21..99 CDD:285071 8/34 (24%)
COG5048 <353..554 CDD:227381 48/165 (29%)
C2H2 Zn finger 364..384 CDD:275368 5/19 (26%)
C2H2 Zn finger 395..416 CDD:275368 8/20 (40%)
C2H2 Zn finger 424..444 CDD:275368 7/21 (33%)
C2H2 Zn finger 452..472 CDD:275368 9/19 (47%)
C2H2 Zn finger 479..499 CDD:275368 5/19 (26%)
C2H2 Zn finger 507..527 CDD:275368 2/6 (33%)
zf-H2C2_2 520..544 CDD:290200
C2H2 Zn finger 535..553 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.