DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30020 and znf131

DIOPT Version :9

Sequence 1:NP_610627.2 Gene:CG30020 / 36156 FlyBaseID:FBgn0050020 Length:1309 Species:Drosophila melanogaster
Sequence 2:NP_956799.2 Gene:znf131 / 393477 ZFINID:ZDB-GENE-040426-1563 Length:558 Species:Danio rerio


Alignment Length:428 Identity:84/428 - (19%)
Similarity:146/428 - (34%) Gaps:96/428 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   900 TTTMATSSSTISEPVNSVTVDGQHNEMMQTDVGAEKMTEALGNGDGNEEGG-------------- 950
            |.|:|.:.   .|.|:.|....::.:|.:    |.|......||..:.:.|              
Zfish    91 TATLAVNG---EEEVSDVWRAAEYLQMQE----AIKALNNRRNGTTSPQPGKSKAKKRKISETSN 148

  Fly   951 -------TDDGTGVKAEPAVPEEELDPVTLDAATAVTTTAIAAAISAAAAATATSLESPVATTAS 1008
                   :.|...|:.|..|.||.::         |..:.:...:..|...|..|.:.......:
Zfish   149 VITESLPSADTEAVEIEVEVGEEHIE---------VEESGLVEVVDVARGTTVPSSDDSALALLA 204

  Fly  1009 SSTTLFPTPTPF-----DFDYDIMRDE----AQQSSPNIHDVSKALS--DNASSSCPINESYKLL 1062
            ..|:.:......     ..|..::..|    |.::..||..|...:|  ||.......:..:||.
Zfish   205 DITSKYQQGEQTLHVIKKVDETVVVQEEAVVASKTLENIEVVEVQISQLDNLFRCDKCDRCFKLY 269

  Fly  1063 STTALETSPAKGLRSNSRLHRSSIH---ICKLCNQTFDELGKLVKHEMELHSNTE---RSRWGYQ 1121
                      ..|:.:.:.|.:|..   :|:.|.:.:...|.|.:|....|.:.|   |.:....
Zfish   270 ----------YHLKQHMKTHIASPERGFVCRHCGKAYAREGALKQHLNNYHFDAEEQSRRQKKKV 324

  Fly  1122 HKCAICNTSYRTLTLLKFHMKRHSNRKS-QCKLCPKSFVTIAELERHTKAKHSKDKTLRCFMDGC 1185
            |.|..|...:......|.|:::|:..|. :|..|.:.|              :::.||:|.|..|
Zfish   325 HVCEYCEKQFDHFGHFKEHLRKHTGEKPFECPECHERF--------------ARNSTLKCHMSAC 375

  Fly  1186 RKTFAFKHHLIRHQKASHLSTRYICPVCNKEEKSNVHLKNHMSVHKGEITYKCPKCDRSYLRRGR 1250
            :.....|    :.:|     ..|.|.||:....|....|:|:..|.||....|..||..:.....
Zfish   376 QNGSGAK----KGRK-----KLYECQVCSSVFNSWEQFKDHLVTHTGEKPNHCTLCDLWFTSPRD 431

  Fly  1251 LVTHALIIHDLR---FTTEEL-----GNLSSLATNQAR 1280
            |.||....|.|:   ...|::     .|:.|:...:.|
Zfish   432 LHTHLQEHHSLQEKVIVAEDILISDPANVLSMEEGEER 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30020NP_610627.2 zf-AD 25..106 CDD:285071
C2H2 Zn finger 369..389 CDD:275368
C2H2 Zn finger 397..418 CDD:275368
C2H2 Zn finger 442..460 CDD:275368
C2H2 Zn finger 730..750 CDD:275368
C2H2 Zn finger 758..777 CDD:275368
C2H2 Zn finger 1089..1110 CDD:275368 5/20 (25%)
C2H2 Zn finger 1124..1144 CDD:275368 4/19 (21%)
C2H2 Zn finger 1151..1172 CDD:275368 3/20 (15%)
C2H2 Zn finger 1180..1203 CDD:275368 5/22 (23%)
C2H2 Zn finger 1210..1230 CDD:275368 6/19 (32%)
C2H2 Zn finger 1238..1254 CDD:275368 4/15 (27%)
znf131NP_956799.2 BTB 24..120 CDD:306997 8/35 (23%)
zf-C2H2 257..279 CDD:306579 3/31 (10%)
C2H2 Zn finger 259..279 CDD:275368 3/29 (10%)
C2H2 Zn finger 289..347 CDD:275368 13/57 (23%)
COG5048 <310..441 CDD:227381 36/153 (24%)
C2H2 Zn finger 327..344 CDD:275368 3/16 (19%)
zf-H2C2_2 339..364 CDD:316026 7/38 (18%)
C2H2 Zn finger 355..372 CDD:275368 6/30 (20%)
C2H2 Zn finger 419..439 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.