DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30020 and CG8089

DIOPT Version :9

Sequence 1:NP_610627.2 Gene:CG30020 / 36156 FlyBaseID:FBgn0050020 Length:1309 Species:Drosophila melanogaster
Sequence 2:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster


Alignment Length:553 Identity:99/553 - (17%)
Similarity:170/553 - (30%) Gaps:173/553 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   785 RDMVQAKGDKVSVA-RTNIEKLYPGRIKNPMLMCAKCPFECESDSEMRKHLNAHHGINDGVSEHA 848
            |.:.|..|.:...| |..|..|:...::.....|...|::...|.|  .|...|...::      
  Fly   141 RSVSQLAGQEAHGALRPKIAALFLPGLRCDCYKCENLPWKKLQDVE--DHQKTHRYSDN------ 197

  Fly   849 NEVFIIRKLPFECPRCIRSFAAKTTLSRHLQRSHLVDTIIEMQTPHCGEAITTTMATSSSTISEP 913
                      |.|..|.|.|..:.:|:.|:.|.                      :|||..:.| 
  Fly   198 ----------FHCQICYRRFYLQHSLTSHIIRK----------------------STSSRELHE- 229

  Fly   914 VNSVTVDGQHNEMMQTDVGAEKMTEALGNGDGNEEGGTDDGTGVKAEPAVPEEELDPVTLDAATA 978
                  :.::..:::.....|                              |:||: ::|:....
  Fly   230 ------NKRYKRLLENQKSQE------------------------------EKELE-LSLNKVED 257

  Fly   979 VTTTAIAAAISAAAAATATSLESPVATTASSSTTLFPTPTPFDFDYDIMRDEAQQSSPNIHDVSK 1043
            :..                    |||....|                ..:||::      |.:.|
  Fly   258 ILV--------------------PVAEDLQS----------------YFKDESK------HPIQK 280

  Fly  1044 ALSDNASS--SCPINESYKLLSTTALETSPAKGLRSNSRLHRSSIHICKLCNQTFDELGKLVKHE 1106
            ..:.:.|.  ||..|..:.......:.....:.|.:|...|      |..||::|.....|.||:
  Fly   281 RKTSSLSKCPSCAQNYGFSFSHQLHMVKHRRERLYTNFPFH------CSFCNRSFLTRKFLRKHQ 339

  Fly  1107 MELHS-NTERSRWGYQHKCAICNTSYRTLTLLKFHMKRHSNRKSQCKLC--PKSFV-----TIAE 1163
            ..:.: :|...|   ..||..|...::..:.|..|:.|...|:..|.:|  |.|.:     |..|
  Fly   340 QRVRTFSTLLYR---PFKCPHCTWRFQLKSALDSHVLRIHERRKPCLICKLPTSRLCCSAHTSKE 401

  Fly  1164 LERHTKAKHSKDKTLR--------------CFMDGCRKTFAFKHHLIRHQKASHLSTR-YICPVC 1213
            ..|..:....|.:.||              |.:  |.:.|..|..|..|...:||:.| :.|.:|
  Fly   402 CNRAMQKYRDKMRPLREPPKGGCRKQPTPVCKI--CNRKFTRKFFLEEHMNKAHLNKRNFTCEIC 464

  Fly  1214 NKEEKSNVHLKNHMSVHKGEI-----TYKCPKCDRSYLRRGRLVTHALIIHDLRFTTEELGNLSS 1273
            .    :|.:.:..|..|:..:     |.:|..||.:...:|....|..       :.....||..
  Fly   465 G----ANFYSQGTMQTHRKAVHLLVHTVQCEVCDLTIKSKGNYRRHCK-------SQSHKDNLVK 518

  Fly  1274 LATNQARPNDLKVATPVGLLDGRKDVSGASEEN 1306
            ...|..:..|..........|.:.|:..:|..|
  Fly   519 FGKNNDKTKDSNRRKGARTTDEKLDIEASSSTN 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30020NP_610627.2 zf-AD 25..106 CDD:285071
C2H2 Zn finger 369..389 CDD:275368
C2H2 Zn finger 397..418 CDD:275368
C2H2 Zn finger 442..460 CDD:275368
C2H2 Zn finger 730..750 CDD:275368
C2H2 Zn finger 758..777 CDD:275368
C2H2 Zn finger 1089..1110 CDD:275368 7/20 (35%)
C2H2 Zn finger 1124..1144 CDD:275368 4/19 (21%)
C2H2 Zn finger 1151..1172 CDD:275368 7/27 (26%)
C2H2 Zn finger 1180..1203 CDD:275368 6/22 (27%)
C2H2 Zn finger 1210..1230 CDD:275368 4/19 (21%)
C2H2 Zn finger 1238..1254 CDD:275368 4/15 (27%)
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 3/19 (16%)
C2H2 Zn finger 322..343 CDD:275368 7/20 (35%)
C2H2 Zn finger 355..376 CDD:275368 5/20 (25%)
C2H2 Zn finger 432..453 CDD:275368 6/22 (27%)
C2H2 Zn finger 461..486 CDD:275368 5/28 (18%)
C2H2 Zn finger 490..506 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440011
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.