DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30020 and ZFP92

DIOPT Version :9

Sequence 1:NP_610627.2 Gene:CG30020 / 36156 FlyBaseID:FBgn0050020 Length:1309 Species:Drosophila melanogaster
Sequence 2:NP_001129745.1 Gene:ZFP92 / 139735 HGNCID:12865 Length:416 Species:Homo sapiens


Alignment Length:433 Identity:101/433 - (23%)
Similarity:143/433 - (33%) Gaps:106/433 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   881 SHLVDTIIEMQTPHC------GEA-----ITTTMATSSSTISEPVNSVTVDGQHNEMMQTDVGAE 934
            ||||........||.      ||.     |..|.||:...|.:...|           :|....:
Human    48 SHLVSLGFSFSKPHLISQLERGEGPWVADIPRTWATAGLHIGDRTQS-----------KTSTSTQ 101

  Fly   935 KMTEALGNGDGNEEGGTDDGTGVKAEPAVPEEELDPVTLDAATAVTTTAIAAAISAAAAATATSL 999
            |.:       |.:..|.|...|.:.:                 |..::.:.........::|...
Human   102 KHS-------GRQLPGADPQGGKEGQ-----------------AARSSVLQRGAQGLGQSSAAGP 142

  Fly  1000 ESPVATTASSSTTLFPTPTPFDFDYDIMRDEAQQSSPNIHDVSKALSDNASSSCPINESYKLLST 1064
            :.|..  |............|....::::...      ||...|..      :||  |..||.. 
Human   143 QGPKG--AEKRYLCQQCGKAFSRSSNLIKHRI------IHSGEKPY------ACP--ECGKLFR- 190

  Fly  1065 TALETSPAKGLRSNSRLHRSSIH------ICKLCNQTFDELGKLVKHEMELHSNTERSRWGYQHK 1123
                       ||.:.|....||      .|..|::||.....|:||:: :||. ||     ...
Human   191 -----------RSFALLEHQRIHSGEKPYACPECSKTFTRSSNLIKHQV-IHSG-ER-----PFA 237

  Fly  1124 CAICNTSYRTLTLLKFHMKRHS-NRKSQCKLCPKSFVTIAELERHTKAKHSKDKTLRCFMDGCRK 1187
            |..|...:|....|..|.:.|| .|...|..|.|:|...:.|..|.:. |..:|...|  ..|.|
Human   238 CGDCGKLFRRSFALLEHARVHSGERPYACPECGKAFSRSSNLIEHQRT-HRGEKPYAC--GQCAK 299

  Fly  1188 TFAFKHHLIRHQKASHLSTR-YICPVCNKEEKSNVHLKNHMSVHKGEITYKCPKCDRSYLRRGRL 1251
            .|.....||.||: ||...| :.|..|.|..:....|..|..||.||..|:|..|.:::.||..|
Human   300 AFKGVSQLIHHQR-SHSGERPFACRECGKAFRGRSGLSQHRRVHSGEKPYECSDCGKAFGRRANL 363

  Fly  1252 VTHALIIHDLR-----FTTEELGNLSS-------LATNQARPN 1282
            ..|. .:|..|     .|...|....|       .||:..||:
Human   364 FKHQ-AVHGARRPAKAETARRLAGPGSTGPGSAVAATSPPRPS 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30020NP_610627.2 zf-AD 25..106 CDD:285071
C2H2 Zn finger 369..389 CDD:275368
C2H2 Zn finger 397..418 CDD:275368
C2H2 Zn finger 442..460 CDD:275368
C2H2 Zn finger 730..750 CDD:275368
C2H2 Zn finger 758..777 CDD:275368
C2H2 Zn finger 1089..1110 CDD:275368 7/20 (35%)
C2H2 Zn finger 1124..1144 CDD:275368 5/19 (26%)
C2H2 Zn finger 1151..1172 CDD:275368 6/20 (30%)
C2H2 Zn finger 1180..1203 CDD:275368 8/22 (36%)
C2H2 Zn finger 1210..1230 CDD:275368 5/19 (26%)
C2H2 Zn finger 1238..1254 CDD:275368 5/15 (33%)
ZFP92NP_001129745.1 KRAB 14..74 CDD:214630 8/25 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..125 9/73 (12%)
COG5048 <145..286 CDD:227381 41/176 (23%)
C2H2 Zn finger 154..174 CDD:275368 1/25 (4%)
C2H2 Zn finger 182..202 CDD:275368 8/33 (24%)
C2H2 Zn finger 210..230 CDD:275368 7/20 (35%)
C2H2 Zn finger 238..258 CDD:275368 5/19 (26%)
COG5048 262..>315 CDD:227381 18/56 (32%)
C2H2 Zn finger 266..286 CDD:275368 6/20 (30%)
C2H2 Zn finger 294..314 CDD:275368 8/22 (36%)
C2H2 Zn finger 322..342 CDD:275368 5/19 (26%)
zf-H2C2_2 335..359 CDD:404364 9/23 (39%)
C2H2 Zn finger 350..370 CDD:275368 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 368..416 9/38 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142179
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.