DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG30020 and LOC102554302

DIOPT Version :9

Sequence 1:	NP_610627.2	Gene:	CG30020 / 36156	FlyBaseID:	FBgn0050020	Length:	1309	Species:	Drosophila melanogaster
Sequence 2:	XP_006230434.1	Gene:	LOC102554302 / 102554302	RGDID:	7506689	Length:	275	Species:	Rattus norvegicus

Alignment Length:	90	Identity:	20/90 - (22%)
Similarity:	40/90 - (44%)	Gaps:	16/90 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly   716 DFDDEQSKHLQKPYCIYCNKKFTSQYKFENHMFVHRGLAPYRCELCTNLYNMKRLLIKHYKTVHK 780
            |....|.:|:    |:.|.::||......:|..:|.|..|:.|..|...:. ::..:|.::.:|:
  Rat   174 DIQPSQRRHV----CVDCGRRFTYPSLLISHRRMHSGERPFPCPECGVRFK-RKFAVKAHQWIHR 233

  Fly   781 -----RMPTRDMVQA------KGDK 794
                 |...|..::|      :||:
  Rat   234 SCSGGRRGRRPGIRAVPGAPVRGDR 258

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG30020	NP_610627.2	zf-AD	25..106	CDD:285071
		C2H2 Zn finger	369..389	CDD:275368
		C2H2 Zn finger	397..418	CDD:275368
		C2H2 Zn finger	442..460	CDD:275368
		C2H2 Zn finger	730..750	CDD:275368	5/19 (26%)
		C2H2 Zn finger	758..777	CDD:275368	3/18 (17%)
		C2H2 Zn finger	1089..1110	CDD:275368
		C2H2 Zn finger	1124..1144	CDD:275368
		C2H2 Zn finger	1151..1172	CDD:275368
		C2H2 Zn finger	1180..1203	CDD:275368
		C2H2 Zn finger	1210..1230	CDD:275368
		C2H2 Zn finger	1238..1254	CDD:275368
LOC102554302	XP_006230434.1	KRAB	26..86	CDD:214630
		KRAB	26..65	CDD:279668
		COG5048	<166..>234	CDD:227381	15/64 (23%)
		zf-C2H2	182..204	CDD:278523	6/25 (24%)
		C2H2 Zn finger	184..204	CDD:275368	5/19 (26%)
		zf-H2C2_2	197..221	CDD:290200	6/24 (25%)
		C2H2 Zn finger	212..232	CDD:275368	3/20 (15%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C166335959
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930