DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18004 and Ino80e

DIOPT Version :9

Sequence 1:NP_610625.1 Gene:CG18004 / 36154 FlyBaseID:FBgn0033566 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001013922.1 Gene:Ino80e / 293494 RGDID:1359572 Length:244 Species:Rattus norvegicus


Alignment Length:235 Identity:89/235 - (37%)
Similarity:114/235 - (48%) Gaps:41/235 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GLGAGETDFKERYKNLKKKLKFLIYENEYFQDLLHTNQRRLLKVSRDRTFLLDRLLVYEKPAKDS 118
            |...||.|:|::|:|||:||||||||:|.||:.|...||:|||||||::|||||||.||...:||
  Rat     3 GPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQYENVDEDS 67

  Fly   119 SDSDATDSSDSEPASTSGVAGGSQTSKDAIRRKHKDKGAPGIP---GVPPH----MPTVGAPRGR 176
            ||||||.|||:  :.|.|....|.|.....:|.....|||. |   .:||.    :.|.|||...
  Rat    68 SDSDATASSDN--SETEGTPKLSDTPAPKRKRSPPMGGAPS-PSSLSLPPSSGFPLQTSGAPSPY 129

  Fly   177 RRKILTGMLPANHGIPAIAAKKQLTATVSPSQQPPQLQTAPK-------DVSP------------ 222
            ...:.:...|.   .|:.....||.   .||...|:|:..|:       .|.|            
  Rat   130 LSSLASPPYPP---FPSDYLALQLP---EPSPLRPKLEKRPRLPRKLKMAVGPPDCPVGGPLAFP 188

  Fly   223 --GLSQAEIARQLQERRPTPLELLSPECTSATVPTTMLSD 260
              | |.|.:...|   .|.|...:.|....:|||..|.||
  Rat   189 ARG-SGASVGAAL---TPLPPPKMPPHTILSTVPQQMFSD 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18004NP_610625.1 None
Ino80eNP_001013922.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..179 39/128 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343362
Domainoid 1 1.000 106 1.000 Domainoid score I6428
eggNOG 1 0.900 - - E1_2AISN
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I4832
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008513
OrthoInspector 1 1.000 - - oto98779
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21812
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5692
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.940

Return to query results.
Submit another query.