DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18004 and INO80E

DIOPT Version :9

Sequence 1:NP_610625.1 Gene:CG18004 / 36154 FlyBaseID:FBgn0033566 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_775889.1 Gene:INO80E / 283899 HGNCID:26905 Length:244 Species:Homo sapiens


Alignment Length:255 Identity:85/255 - (33%)
Similarity:115/255 - (45%) Gaps:81/255 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GLGAGETDFKERYKNLKKKLKFLIYENEYFQDLLHTNQRRLLKVSRDRTFLLDRLLVYEKPAKDS 118
            |...||.|:|::|:|||:||||||||:|.||:.|...||:|||||||::|||||||.||...:||
Human     3 GPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQYENVDEDS 67

  Fly   119 SDSDATDSSDSEPASTSGVAGGSQTSKDAIRRKHKDKGAPGIPGVPPHMPTVGAPRGRRRKILTG 183
            ||||||.|||:           |:|           :|.|.:...|       ||:.:|...|.|
Human    68 SDSDATASSDN-----------SET-----------EGTPKLSDTP-------APKRKRSPPLGG 103

  Fly   184 -------MLPANHGIP--AIAAKKQLTATVSPSQQPPQLQTAPKD-VSPGLSQAEIARQLQERRP 238
                   .||.:.|.|  |........::::.|:.||    .|.| ::..|.:....|..:|:||
Human   104 APSPSSLSLPPSTGFPLQASGVPSPYLSSLASSRYPP----FPSDYLALQLPEPSPLRPKREKRP 164

  Fly   239 ------------------------------------TPL--ELLSPECTSATVPTTMLSD 260
                                                |||  ..:.|....:|||..|.||
Human   165 RLPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSD 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18004NP_610625.1 None
INO80ENP_775889.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..236 46/195 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149486
Domainoid 1 1.000 106 1.000 Domainoid score I6640
eggNOG 1 0.900 - - E1_2AISN
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I4946
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008513
OrthoInspector 1 1.000 - - oto91712
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21812
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4864
SonicParanoid 1 1.000 - - X5692
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.