DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18004 and Ino80e

DIOPT Version :9

Sequence 1:NP_610625.1 Gene:CG18004 / 36154 FlyBaseID:FBgn0033566 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001357694.1 Gene:Ino80e / 233875 MGIID:2141881 Length:340 Species:Mus musculus


Alignment Length:259 Identity:93/259 - (35%)
Similarity:121/259 - (46%) Gaps:54/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RGAAPASSSSVSAGLGA---------GETDFKERYKNLKKKLKFLIYENEYFQDLLHTNQRRLLK 96
            ||.|...|.::..|:..         ||.|:|::|:|||:||||||||:|.||:.|...||:|||
Mouse    77 RGRADLGSGTLLRGVSPWRVMNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLK 141

  Fly    97 VSRDRTFLLDRLLVYEKPAKDSSDSDATDSSDSEPASTSGVAGGSQTSKDAIRRKHKDKGAPGIP 161
            ||||::|||||||.||...:||||||||.|||:  :.|.|....|.|...      |.|.:|.:.
Mouse   142 VSRDKSFLLDRLLQYENVDEDSSDSDATASSDN--SETEGTPKLSDTPAP------KRKRSPPMG 198

  Fly   162 GVPPHM-----PTVGAP---RGRRRKILTGML-PANHGIPAIAAKKQLTATVSPSQQPPQLQTAP 217
            |||...     |:.|.|   .|.....|:.:. |.....|:.....||.   .||...|:|:..|
Mouse   199 GVPSPSSLSLPPSTGFPLQTSGAPSPYLSSLASPPYPPFPSDYLALQLP---EPSPLRPKLEKRP 260

  Fly   218 K-------DVSP--------------GLSQAEIARQLQERRPTPLELLSPECTSATVPTTMLSD 260
            :       .|.|              | |.|.:...|   .|.|...:.|....:|||..|.||
Mouse   261 RLPRKLKMSVGPPDCPVGGPLAFPARG-SGASVGAAL---TPLPPPKMPPHTILSTVPQQMFSD 320



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839544
Domainoid 1 1.000 107 1.000 Domainoid score I6566
eggNOG 1 0.900 - - E1_2AISN
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I4910
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008513
OrthoInspector 1 1.000 - - oto95294
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21812
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4864
SonicParanoid 1 1.000 - - X5692
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.970

Return to query results.
Submit another query.