DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18004 and ino80e

DIOPT Version :9

Sequence 1:NP_610625.1 Gene:CG18004 / 36154 FlyBaseID:FBgn0033566 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_002940818.2 Gene:ino80e / 100169675 XenbaseID:XB-GENE-5715507 Length:241 Species:Xenopus tropicalis


Alignment Length:235 Identity:80/235 - (34%)
Similarity:105/235 - (44%) Gaps:58/235 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ETDFKERYKNLKKKLKFLIYENEYFQDLLHTNQRRLLKVSRDRTFLLDRLLVYEKPAKDSSDSDA 123
            |.|:|.:|||||:||||||||.|.||:.|...||:|||||||::|||||:|.||...:||||||.
 Frog     8 EVDYKRKYKNLKRKLKFLIYEQECFQEELRRAQRKLLKVSRDKSFLLDRILQYENVDEDSSDSDV 72

  Fly   124 TDSSDSEPASTSGVAGGSQTSKDAIRRKHKDKGAPGIPGVPP-----HMPTVGAPRGRRRKILTG 183
            |.||::     |...||...|....:||.........|..|.     .:.|.|.|          
 Frog    73 TASSEN-----SDTEGGRGPSTPPTKRKRSPPAGSASPQPPSCTSGLSLHTAGGP---------- 122

  Fly   184 MLPANHGIPAIAAKKQLTATVSPSQQPPQLQTAPKDVSPGLSQAEIARQLQERRP-TPLELLSPE 247
            .|.|....|......:..|.: |:..||:.:.|.:|   |.:     |.::.::| .||. .||.
 Frog   123 YLSAMSSPPYTPFPSEYLAPL-PNSTPPKPERAKRD---GKN-----RGVKPKKPKIPLS-SSPS 177

  Fly   248 CTS---------------------------ATVPTTMLSD 260
            |..                           :|||..|.||
 Frog   178 CGGVLPFSPRSSSLPPLSSSSKHTPPPTILSTVPQQMFSD 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18004NP_610625.1 None
ino80eXP_002940818.2 DegS <18..>49 CDD:377505 21/30 (70%)
PHA03247 <85..183 CDD:223021 25/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7038
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I4879
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008513
OrthoInspector 1 1.000 - - oto105473
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5692
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.