DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12344 and Gabre

DIOPT Version :9

Sequence 1:NP_001286298.1 Gene:CG12344 / 36145 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_075579.1 Gene:Gabre / 65191 RGDID:68320 Length:989 Species:Rattus norvegicus


Alignment Length:481 Identity:128/481 - (26%)
Similarity:201/481 - (41%) Gaps:88/481 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SEATEAHMNYTAKPRVVLP----------PNYVKEIRPPSKKGSPVIVDFSIFVVDINSINVEDM 77
            :|.|..|.  |.:||..|.          .||..::| ||....|.:|...:||..:..|::.||
  Rat   537 TELTADHT--TERPRGKLTRASQILNTILSNYDHKLR-PSIGEKPTVVTVKVFVNSLGPISILDM 598

  Fly    78 DFRVDMFIHQRWLESRLEIPDDIFEEGDDYVTLLPEVFENFWQPDPYFLNSKIAEIATLTHKFTS 142
            ::.:|:..:|.|.:.||.. :|.||.    :.|...|....|.||.:|.|||..:...:|.....
  Rat   599 EYSIDIIFYQTWYDERLRY-NDTFET----LILHGNVVSQLWIPDTFFRNSKRTQEYDITIPNQM 658

  Fly   143 VTLYKNKTVRYAARMHAIIACQMEFQLYPMDIQVCPIYIESFSSNNQKVKLRWSDSGVTLNPELK 207
            ..::|:..|.|..||.....|.:....:|||...||:...|||.:..::..:|.      |.:||
  Rat   659 ALIHKDGKVLYTVRMTIDARCSLHMLNFPMDSHSCPLSFSSFSYDEHEMIYKWE------NFKLK 717

  Fly   208 LLQYNLGQPLELE-----ESDGYMPEKVGNFSRLTVYFRFERQIGHHLIQTFAPSSLVVMLSWFS 267
            :...|..:.||.:     .....:...||:|..:|.:|...|:.|..:.|.:.|||:..||||.|
  Rat   718 IDAKNTWKLLEFDFTGVNNKTEIISTPVGDFMVMTFFFNVSRRFGFIVFQNYIPSSVTTMLSWVS 782

  Fly   268 FWLGLDAIPGRVTLLVTCMLTLVTM--FTGADIPPVAYVKALDLWMAGCMLSVFAALAEFVVVKV 330
            ||:.::|...|.::.|:.:||:.|:  |:..:.|.|:|:.|||.::|.|.:..|..|.||.|:..
  Rat   783 FWIKIEAAAARASVGVSSVLTMATLGTFSRKNFPRVSYLTALDFYIAICFVLCFCTLLEFTVLNF 847

  Fly   331 LDVQ----------YQYQVNRIPKVLPMRISNMEKGQCATVASWEGGAVRSRKATQTP------T 379
            |...          ||:..|       .|.:...:.:..|.|     ..|:|...|..      .
  Rat   848 LTYNNIERQASPKFYQFPTN-------SRANARTRARARTRA-----RARARARQQQEVFVCEIV 900

  Fly   380 TPGQTSLQGNGGPPKPARRQSLLSVAWTDTD----------------TGVEKIMWR--------- 419
            |..:.:.:|....|:..|.|    ..|....                .|.|...|:         
  Rat   901 TYEENAEEGYQWSPRSRRPQ----CPWRRCGRSYVCFRVLRKYFCMVPGCEGNSWQRGRICIHVY 961

  Fly   420 EIDKVSRAVFPILFFVFVLLYWPILL 445
            .:|..||.:|||.||.|.::||.|.|
  Rat   962 RLDNYSRVLFPITFFFFNVVYWVICL 987

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12344NP_001286298.1 LIC 8..441 CDD:273305 124/475 (26%)
GabreNP_075579.1 Neur_chan_LBD 555..760 CDD:280998 56/216 (26%)
LIC 557..983 CDD:273305 117/453 (26%)
Neur_chan_memb 769..983 CDD:280999 58/229 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1057372at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.