DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12344 and glrbb

DIOPT Version :9

Sequence 1:NP_001286298.1 Gene:CG12344 / 36145 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_021336678.1 Gene:glrbb / 445193 ZFINID:ZDB-GENE-040801-106 Length:502 Species:Danio rerio


Alignment Length:465 Identity:128/465 - (27%)
Similarity:210/465 - (45%) Gaps:100/465 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YVKEIRPPSKKGSPVIVDFSIFVVDINSINVEDMDFRVDMFIHQRWLESRLEIPDDIFEEGDDYV 108
            |...|| |:.||.||....:||:....||....||:||::|:.|||.:.||.:|.|.   ..|.:
Zfish    75 YDPRIR-PNFKGIPVEDRVNIFINSFGSIQETTMDYRVNIFLRQRWNDPRLRLPQDF---KSDSL 135

  Fly   109 TLLPEVFENFWQPDPYFLNSKIAEIATLTHKFTSVTLYKNKTVRYAARMHAIIACQMEFQLYPMD 173
            |:.|::|:..|:||.:|.|.|.|....:|.:...:.:::|..|..:.|:...::|.::..|:|||
Zfish   136 TVDPKMFKCLWKPDLFFANEKSANFHDVTQENILLFIFRNGDVLISMRLSVTLSCPLDLTLFPMD 200

  Fly   174 IQVCPIYIESFSSNNQKVKLRWSDSGVTLNPELKLLQYNLGQ-PLELEESDGYMPEKVGNFSRLT 237
            .|.|.:.:|||......::..|.........|:.|.|:::.| .:|......|. ...|.::.:.
Zfish   201 TQRCKMQLESFGYTTDDLQFMWQSGDPVQMDEIALPQFDIKQEDIEYGNCTKYY-AGTGYYTCVE 264

  Fly   238 VYFRFERQIGHHLIQTFAPSSLVVMLSWFSFWLGLDAIPGRVTLLVTCMLTLVTMFT--GADIPP 300
            |.|...||:|.:::..:||:.|:|:|||.|||:..||...||.|.:..:|:|.:..|  .:::|.
Zfish   265 VIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVPLGILSVLSLSSECTSLASELPK 329

  Fly   301 VAYVKALDLWMAGCMLSVFAALAEFVVVKVLDVQYQYQVNRIPKVLPMRISNMEKGQCATVASWE 365
            |:||||:|:|:..|:|..||:|.|:.||:|:       :|. ||:|     ..|:.:.||....|
Zfish   330 VSYVKAIDIWLIACLLFGFASLVEYAVVQVM-------LNS-PKLL-----EAERAKIATKEKAE 381

  Fly   366 GGAVRSRKATQTPTTPGQTSLQGNGGPPKPARRQSLLSVAWTDTDTGVEKIMW------------ 418
            |            .||.:.::.|.|..|   ...|.|.|    |:|..:|:..            
Zfish   382 G------------KTPAKNTINGMGSTP---IHVSTLQV----TETRCKKVCTSKSDLRTNDFSI 427

  Fly   419 ------------------------------------------------REIDKVSRAVFPILFFV 435
                                                            :.||..:||:||..|..
Zfish   428 VGSLPRDFELSNFDCYGKPIEVGSAFSKSQAKNNKKPPPPKPVIPSAAKRIDLYARALFPFSFLF 492

  Fly   436 FVLLYWPILL 445
            |.::||.:.|
Zfish   493 FNVIYWSVYL 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12344NP_001286298.1 LIC 8..441 CDD:273305 125/459 (27%)
glrbbXP_021336678.1 Neur_chan_LBD 53..501 CDD:332142 127/462 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.