DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12344 and NtR

DIOPT Version :9

Sequence 1:NP_001286298.1 Gene:CG12344 / 36145 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster


Alignment Length:356 Identity:69/356 - (19%)
Similarity:125/356 - (35%) Gaps:108/356 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NTNAFISFG---------LGF------ILMWLSEATE-----AHMNYTAKPRVVLPPNYVKEIRP 50
            |..:|.|||         .||      |...:.|.|:     :|:|..|: ...:|.|.      
  Fly   179 NYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAE-NASMPANL------ 236

  Fly    51 PSKKGSPVIVDF---SIFVVDINSINVEDMDFRVDMFIHQRWLESRLEIPDDIFEEGDDYVTLLP 112
                 |.:...|   |:.....:|:    :..|:.|.:|  |.:|||      ..:.:|:.:|  
  Fly   237 -----SSISFHFQTRSLAYEQTSSL----LQTRMHMMMH--WRDSRL------VWKPEDFGSL-- 282

  Fly   113 EVFEN----FWQPDPYFLNSKIAEIATLTHKFTSVTLYKNKTVR-YAARMHAIIACQMEFQLYPM 172
            |.||:    .|:|....||..:..:..:...: .:.:|.|.::. ||..:.....|....:.:|.
  Fly   283 ESFEHPDLRIWKPHMNVLNGALQSMGQVLQSY-ELMVYANGSITLYAQNLQLASWCVDSARNWPS 346

  Fly   173 DIQVCPIYIESFSSNNQK-VKLRWSDSGVTLNPELKLLQYNLGQP---------LELEESDG--- 224
            :...|.|.:.......|: |.|.:.|....:.|     ..::..|         :.|.|:|.   
  Fly   347 ERVTCDIELGLNGQEGQENVALIYDDQRKPIAP-----NEHVNTPSGWSFTQMSVVLVENDSQRR 406

  Fly   225 YMPEKVGNFSRLT----VYFRFERQIGHHLIQTFAP-------------------SSLVVMLSWF 266
            |.|:  |...::|    :.|..:|....::...:.|                   |||:::....
  Fly   407 YNPK--GMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLI 469

  Fly   267 SFWLGL---------DAIPGRVTLLVTCMLT 288
            :.| ||         ..:|..:|.....|:|
  Fly   470 AAW-GLMYMTRYASPHYVPPMMTAYKVIMMT 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12344NP_001286298.1 LIC 8..441 CDD:273305 68/354 (19%)
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 5/11 (45%)
Neur_chan_LBD 212..429 CDD:280998 49/250 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.