DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12344 and GluClalpha

DIOPT Version :9

Sequence 1:NP_001286298.1 Gene:CG12344 / 36145 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001287408.1 Gene:GluClalpha / 42350 FlyBaseID:FBgn0024963 Length:463 Species:Drosophila melanogaster


Alignment Length:468 Identity:131/468 - (27%)
Similarity:210/468 - (44%) Gaps:72/468 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SEATEAHMNYTAKPRVVLPP-----NYVKEIRPPSKKGS--PVIVDFSIFVVDINSINVEDMDFR 80
            |.|..|.:|:..|.:.||..     .|...|||....|:  |.:|..:|||..|:.|:...|::.
  Fly    20 SLANNAKINFREKEKKVLDQILGAGKYDARIRPSGINGTDGPAVVRVNIFVRSISKIDDVTMEYS 84

  Fly    81 VDMFIHQRWLESRLEIPDDIFEEGD-DYVTLLPEVFENFWQPDPYFLNSKIAEIATLTHKFTSVT 144
            |.:...::|.:.||:. |||  :|. .|:||...  ...|.||.:|.|.|......:......:.
  Fly    85 VQLTFREQWTDERLKF-DDI--QGRLKYLTLTEA--NRVWMPDLFFSNEKEGHFHNIIMPNVYIR 144

  Fly   145 LYKNKTVRYAARMHAIIACQMEFQLYPMDIQVCPIYIESFSSNNQKVKLRWSDSG-VTLNPELKL 208
            ::.|.:|.|:.|:...:||.|..:|||:|.|:|.:.:.|:......:...|.:.. |.:...|.|
  Fly   145 IFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHL 209

  Fly   209 LQYNLGQPLELEESDGYMPEK--VGNFSRLTVYFRFERQIGHHLIQTFAPSSLVVMLSWFSFWLG 271
            .::.|.:.|     ..|...|  .|.:|.|.|...|:|:..::|||.:.|..::|::||.||||.
  Fly   210 PRFTLEKFL-----TDYCNSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLD 269

  Fly   272 LDAIPGRVTLLVTCMLTLVTMFTG--ADIPPVAYVKALDLWMAGCMLSVFAALAEFVVVKVLDVQ 334
            ..|:|.||:|.||.:||:.|..:|  |.:|||:|.||:|:|...|:..||.||.||.:|......
  Fly   270 QGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRS 334

  Fly   335 YQYQVNRIPKVLPMRISNMEK----------------------GQCATVASWEGGAVRSRKATQT 377
            ...:.|       |...||:|                      ...|..:.:..|..:.:...:.
  Fly   335 GSNKAN-------MHKENMKKKRRDLEQASLDAASDLLDTDSNATFAMASQFARGGGQQKPLVRH 392

  Fly   378 PTTP--------GQTSLQGNGGPPKPARRQSLLSVAWTDTDTGVEKIMWREIDKVSRAVFPILFF 434
            |..|        .:..:|   .|.:|...::.||...|.:         :.||.:||..||::|.
  Fly   393 PGDPLALEKRLQCEVHMQ---APKRPNCCKTWLSKFPTRS---------KRIDVISRITFPLVFA 445

  Fly   435 VFVLLYWPILLMK 447
            :|.|:||...|.:
  Fly   446 LFNLVYWSTYLFR 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12344NP_001286298.1 LIC 8..441 CDD:273305 128/460 (28%)
GluClalphaNP_001287408.1 LIC 3..455 CDD:273305 130/463 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18945
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.