DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12344 and srsx-31

DIOPT Version :9

Sequence 1:NP_001286298.1 Gene:CG12344 / 36145 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001023767.1 Gene:srsx-31 / 3565162 WormBaseID:WBGene00008552 Length:308 Species:Caenorhabditis elegans


Alignment Length:232 Identity:42/232 - (18%)
Similarity:86/232 - (37%) Gaps:77/232 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 IIACQMEFQLYPMDIQVCPIYIESFSSNNQKVKLRWSDSGVTLNPEL-----KLLQYNLG----Q 215
            ||||:     :|:..::    :.|:.|....::|.:.   :|....|     :.:.||..    .
 Worm   105 IIACR-----FPITYRL----LLSYGSVYLGIQLIFP---ITFTSALMIYGYQFIDYNTQIICMA 157

  Fly   216 PLEL-EESDGYM--PEKVGNFSRLTVY-FRF-------ERQIG--HHLIQTFAPSSLVVMLSWFS 267
            ||.| .::.||.  ...:.|...:.|| :.:       ||...  .::.::.|.:.:||::.|.:
 Worm   158 PLALPRQAFGYFTYSSNIINVKIVIVYAYTYFVLRGYKERDANRMRYVFKSIALTVIVVLIGWTT 222

  Fly   268 FWLG----LDAIPGRVTLLVTCMLTLVTMFTGADIPPVAYVKALDLWMAGCMLSVFAALAEFVVV 328
            ..:|    |..|..|.|      ..::::..|..:            ...|.::|       :|.
 Worm   223 VTIGNTIALGVIEDRHT------SEIISIHAGFGV------------NISCSINV-------IVF 262

  Fly   329 KVLDVQYQYQVNRI--------------PKVLPMRIS 351
            ..::.:|:..:.|:              |.|:..|||
 Worm   263 YAINSEYRSAIRRLFGMKIHSSDVSKSDPSVITKRIS 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12344NP_001286298.1 LIC 8..441 CDD:273305 42/232 (18%)
srsx-31NP_001023767.1 TM helix 1 11..36 CDD:341315
7TM_GPCR_Srsx 19..277 CDD:255903 37/208 (18%)
TM helix 2 43..67 CDD:341315
TM helix 3 79..109 CDD:341315 3/3 (100%)
TM helix 4 122..140 CDD:341315 3/20 (15%)
TM helix 5 165..190 CDD:341315 5/24 (21%)
TM helix 6 201..230 CDD:341315 5/28 (18%)
TM helix 7 241..266 CDD:341315 4/43 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.