DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12344 and Gabra1

DIOPT Version :9

Sequence 1:NP_001286298.1 Gene:CG12344 / 36145 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_899155.1 Gene:Gabra1 / 29705 RGDID:61855 Length:455 Species:Rattus norvegicus


Alignment Length:441 Identity:124/441 - (28%)
Similarity:202/441 - (45%) Gaps:61/441 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NYTAKPRVV--LPPNYVKEIRPP-SKKGSPVIVDFSIFVVDINSINVEDMDFRVDMFIHQRWLES 92
            |.|...|::  |...|...:||. .::.:.|..|  |||.....::..||::.:|:|..|.|.:.
  Rat    37 NTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTD--IFVTSFGPVSDHDMEYTIDVFFRQSWKDE 99

  Fly    93 RLEIPDDIFEEGDDYVTLLPEVF-ENFWQPDPYFLNSK--IAEIATLTHKFTSVTLYKNKTVRYA 154
            ||:.      :|...|..|..:. ...|.||.:|.|.|  :|...|:.:|...:|  ::.|:.|.
  Rat   100 RLKF------KGPMTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIT--EDGTLLYT 156

  Fly   155 ARMHAIIACQMEFQLYPMDIQVCPIYIESFSSNNQKVKLRW----SDSGVTLNPELKLLQYN-LG 214
            .|:.....|.|..:.:|||...||:...|::....:|...|    :.|.|......:|.||: ||
  Rat   157 MRLTVRAECPMHLEDFPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLG 221

  Fly   215 QPLELEESDGYMPEKVGNFSRLTVYFRFERQIGHHLIQTFAPSSLVVMLSWFSFWLGLDAIPGRV 279
            |.::    .|.:....|.:..:|.:|..:|:||:.:|||:.|..:.|:||..||||..:::|.|.
  Rat   222 QTVD----SGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPART 282

  Fly   280 TLLVTCMLTLVTMFTGA--DIPPVAYVKALDLWMAGCMLSVFAALAEFVVVKVLDVQ-YQYQVNR 341
            ...||.:||:.|:...|  .:|.|||..|:|.::|.|...||:||.||..|.....: |.:....
  Rat   283 VFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKS 347

  Fly   342 IPKVLPMRISN--MEKGQ--CATVASW--------EGGAVRSRKATQTPTTPGQTSLQGNGGPPK 394
            :....|.::.:  ::|..  ..|..|:        .|.|..::.||..|     ..::....||:
  Rat   348 VVPEKPKKVKDPLIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEP-----KEVKPETKPPE 407

  Fly   395 PARRQSLLSVAWTDTDTGVEKIMWREIDKVSRAVFPILFFVFVLLYWPILL 445
            |.:           |...|.|     ||::||..||:||.:|.|:||...|
  Rat   408 PKK-----------TFNSVSK-----IDRLSRIAFPLLFGIFNLVYWATYL 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12344NP_001286298.1 LIC 8..441 CDD:273305 121/435 (28%)
Gabra1NP_899155.1 LIC 7..441 CDD:273305 123/438 (28%)
LGIC_ECD_GABAAR_A1 55..248 CDD:349835 53/206 (26%)
Cys-loop 165..179 CDD:349835 5/13 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1057372at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.